From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005689000
  • symbol?: rpsN
  • description?: 30S ribosomal protein S14

      descriptions from strain specific annotations:

    • 30S ribosomal protein S14
    • 30S ribosomal protein S14 type Z
    • ribosomal protein S14p/S29e
    • ribosomal protein S14p/S29e family protein
  • strand?: -
  • coordinates?: 5804724..5804894
  • synteny block?: BlockID0044350
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2226 (rpsN)
    N315:
    SAS079 (rpsN)
    NCTC8325:
    Newman:
    NWMN_2139 (rpsN)
    USA300_FPR3757:
    04-02981:
    SA2981_2175 (rpsN)
    08BA02176:
    C248_2273 (rpsN)
    11819-97:
    MS7_2257 (rpsN1)
    71193:
    ST398NM01_2290
    ECT-R 2:
    ECTR2_2099
    ED133:
    SAOV_2274c
    ED98:
    SAAV_2299 (rpsN_1)
    HO 5096 0412:
    SAEMRSA15_21360 (rpsN)
    JH1:
    SaurJH1_2305 (rpsN)
    JH9:
    SaurJH9_2264 (rpsN)
    JKD6008:
    SAA6008_02274 (rpsN_2)
    JKD6159:
    SAA6159_02144 (rpsN_2)
    LGA251:
    SARLGA251_20230 (rpsN)
    M013:
    MRSA252:
    SAR2322 (rpsN)
    MSHR1132:
    SAMSHR1132_20630
    MSSA476:
    SAS2128 (rpsN)
    Mu3:
    SAHV_2221 (rpsN)
    Mu50:
    SAV2237 (rpsN)
    MW2:
    MW2156 (rpsN)
    RF122:
    SAB2109c (rpsN)
    ST398:
    SAPIG2290 (rpsN)
    T0131:
    SAT0131_02410 (pdhC)
    TCH60:
    HMPREF0772_10961 (rpsN)
    TW20:
    SATW20_23710 (rpsN)
    USA300_TCH1516:
    USA300HOU_2228 (rpsN)
    VC40:
    SAVC_10055 (rpsN)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKTSMVAKQQKKQKYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKAS
    N315            MAKTSMVAKQQKKQKYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKAS
    NCTC8325        MAKTSMVAKQQKKQKYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKAS
    Newman          MAKTSMVAKQQKKQKYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKAS
    USA300_FPR3757  MAKTSMVAKQQKKQKYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKAS
                    ************************************************************

    COL             W
    N315            W
    NCTC8325        W
    Newman          W
    USA300_FPR3757  W
                    *