From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005694000
  • symbol?: rpmC
  • description?: 50S ribosomal protein L29
  • strand?: -
  • coordinates?: 5806538..5806747
  • synteny block?: BlockID0044400
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2231 (rpmC)
    N315:
    SA2039 (rpmC)
    NCTC8325:
    Newman:
    NWMN_2144 (rpmC)
    USA300_FPR3757:
    04-02981:
    SA2981_2180 (rpmC)
    08BA02176:
    C248_2278 (rpmC)
    11819-97:
    MS7_2262 (rpmC)
    71193:
    ST398NM01_2295
    ECT-R 2:
    ECTR2_2104 (rpmC)
    ED133:
    SAOV_2279c
    ED98:
    SAAV_2304 (rpmC)
    HO 5096 0412:
    SAEMRSA15_21410 (rpmC)
    JH1:
    SaurJH1_2310
    JH9:
    SaurJH9_2269
    JKD6008:
    SAA6008_02279 (rpmC)
    JKD6159:
    SAA6159_02149 (rpmC)
    LGA251:
    SARLGA251_20280 (rpmC)
    M013:
    M013TW_2201
    MRSA252:
    SAR2327 (rpmC)
    MSHR1132:
    SAMSHR1132_20680
    MSSA476:
    SAS2133
    Mu3:
    SAHV_2226 (rpmC)
    Mu50:
    SAV2242 (rpmC)
    MW2:
    MW2161 (rpmC)
    RF122:
    SAB2114c (rpmC)
    ST398:
    SAPIG2295 (rpmC)
    T0131:
    SAT0131_02415 (potB)
    TCH60:
    HMPREF0772_10956 (rpmC)
    TW20:
    SATW20_23760 (rpmC)
    USA300_TCH1516:
    USA300HOU_2233 (rpmC)
    VC40:
    SAVC_10080

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ----MKAKEIRDLTTSEIEEQIKSSKEELFNLRFQLATGQLEETARIRTVRKTIARLKTV
    N315            ----MKAKEIRDLTTSEIEEQIKSSKEELFNLRFQLATGQLEETARIRTVRKTIARLKTV
    NCTC8325        ----MKAKEIRDLTTSEIEEQIKSSKEELFNLRFQLATGQLEETARIRTVRKTIARLKTV
    Newman          MVKQMKAKEIRDLTTSEIEEQIKSSKEELFNLRFQLATGQLEETARIRTVRKTIARLKTV
    USA300_FPR3757  MVKQMKAKEIRDLTTSEIEEQIKSSKEELFNLRFQLATGQLEETARIRTVRKTIARLKTV
                        ********************************************************

    COL             AREREIEQSKANQ
    N315            AREREIEQSKANQ
    NCTC8325        AREREIEQSKANQ
    Newman          AREREIEQSKANQ
    USA300_FPR3757  AREREIEQSKANQ
                    *************