From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005697000
  • symbol?: rplV
  • description?: 50S ribosomal protein L22
  • strand?: -
  • coordinates?: 5807851..5808204
  • synteny block?: BlockID0044430
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2234 (rplV)
    N315:
    SA2042 (rplV)
    NCTC8325:
    Newman:
    NWMN_2147 (rplV)
    USA300_FPR3757:
    04-02981:
    SA2981_2183 (rplV)
    08BA02176:
    C248_2281 (rplV)
    11819-97:
    MS7_2265 (rplV)
    71193:
    ST398NM01_2298
    ECT-R 2:
    ECTR2_2107 (rplV)
    ED133:
    SAOV_2282c
    ED98:
    SAAV_2307 (rplV)
    HO 5096 0412:
    SAEMRSA15_21440 (rplV)
    JH1:
    SaurJH1_2313 (rplV)
    JH9:
    SaurJH9_2272 (rplV)
    JKD6008:
    SAA6008_02282 (rplV)
    JKD6159:
    SAA6159_02152 (rplV)
    LGA251:
    SARLGA251_20310 (rplV)
    M013:
    M013TW_2204
    MRSA252:
    SAR2330 (rplV)
    MSHR1132:
    SAMSHR1132_20710
    MSSA476:
    SAS2136 (rplV)
    Mu3:
    SAHV_2229 (rplV)
    Mu50:
    SAV2245 (rplV)
    MW2:
    MW2164 (rplV)
    RF122:
    SAB2117c (rplV)
    ST398:
    SAPIG2298 (rplV)
    T0131:
    SAT0131_02418
    TCH60:
    HMPREF0772_10953 (rplV)
    TW20:
    SATW20_23790 (rplV)
    USA300_TCH1516:
    USA300HOU_p3
    VC40:
    SAVC_10095 (rplV)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEAKAVARTIRIAPRKVRLVLDLIRGKNAAEAIAILKLTNKASSPVIEKVLMSALANAEH
    N315            MEAKAVARTIRIAPRKVRLVLDLIRGKNAAEAIAILKLTNKASSPVIEKVLMSALANAEH
    NCTC8325        MEAKAVARTIRIAPRKVRLVLDLIRGKNAAEAIAILKLTNKASSPVIEKVLMSALANAEH
    Newman          MEAKAVARTIRIAPRKVRLVLDLIRGKNAAEAIAILKLTNKASSPVIEKVLMSALANAEH
    USA300_FPR3757  MEAKAVARTIRIAPRKVRLVLDLIRGKNAAEAIAILKLTNKASSPVIEKVLMSALANAEH
                    ************************************************************

    COL             NYDMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGKEEAKEA
    N315            NYDMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGKEEAKEA
    NCTC8325        NYDMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGKEEAKEA
    Newman          NYDMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGKEEAKEA
    USA300_FPR3757  NYDMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGKEEAKEA
                    *********************************************************