From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005709000
  • symbol?: glcU
  • description?: glucose uptake protein GlcU

      descriptions from strain specific annotations:

    • glucose uptake protein GlcU
    • sugar transporter
    • glucose uptake protein
    • DMT superfamily drug/metabolite transporter
    • Probable glucose uptake protein glcU
    • putative glucose uptake protein
    • putative glucose uptake protein glcU
    • sugar transport family protein
  • strand?: +
  • coordinates?: 5817205..5818068
  • synteny block?: BlockID0044550
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2194 (glcU)
    08BA02176:
    C248_2292 (glcU)
    11819-97:
    MS7_2276
    71193:
    ST398NM01_2309
    ECT-R 2:
    ECTR2_2118
    ED133:
    SAOV_2294
    ED98:
    SAAV_2318
    HO 5096 0412:
    SAEMRSA15_21550 (glcU)
    JH1:
    SaurJH1_2324
    JH9:
    SaurJH9_2283
    JKD6008:
    SAA6008_02293 (glcU)
    JKD6159:
    SAA6159_02163 (glcU)
    LGA251:
    SARLGA251_20420 (glcU)
    M013:
    M013TW_2215
    MRSA252:
    SAR2341 (glcU)
    MSHR1132:
    SAMSHR1132_20820
    MSSA476:
    SAS2147
    Mu3:
    SAHV_2240
    Mu50:
    SAV2256
    MW2:
    MW2175
    RF122:
    SAB2128 (glcU)
    ST398:
    SAPIG2309
    T0131:
    SAT0131_02429
    TCH60:
    HMPREF0772_10942 (glcU)
    TW20:
    SATW20_23900 (glcU)
    USA300_TCH1516:
    USA300HOU_2238 (glcU)
    VC40:
    SAVC_10150

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQFLDFLIALLPALFWGSVVLINVFVGGGPYNQIRGTTLGALIVGLGLLITGFAKFNNPT
    N315            MQFLDFLIALLPALFWGSVVLINVFVGGGPYNQIRGTTLGALIVGLGLLITGFAKFNNPT
    NCTC8325        MQFLDFLIALLPALFWGSVVLINVFVGGGPYNQIRGTTLGALIVGLGLLITGFAKFNNPT
    Newman          MQFLDFLIALLPALFWGSVVLINVFVGGGPYNQIRGTTLGALIVGLGLLITGFAKFNNPT
    USA300_FPR3757  MQFLDFLIALLPALFWGSVVLINVFVGGGPYNQIRGTTLGALIVGLGLLITGFAKFNNPT
                    ************************************************************

    COL             VIIVGLISGALWAFGQANQLKSISLIGVSNTMPVSTGMQLVGTTLFSVIFLGEWSSMTQI
    N315            VIIVGLISGALWAFGQANQLKSISLIGVSNTMPVSTGMQLVGTTLFSVIFLGEWSSMTQI
    NCTC8325        VIIVGLISGALWAFGQANQLKSISLIGVSNTMPVSTGMQLVGTTLFSVIFLGEWSSMTQI
    Newman          VIIVGLISGALWAFGQANQLKSISLIGVSNTMPVSTGMQLVGTTLFSVIFLGEWSSMTQI
    USA300_FPR3757  VIIVGLISGALWAFGQANQLKSISLIGVSNTMPVSTGMQLVGTTLFSVIFLGEWSSMTQI
                    ************************************************************

    COL             IFGLIAMILLVTGVALTSLKAKNERQSDNPEFKKAMGILIVSTVGYVGFVVLGDIFGVGG
    N315            IFGLIAMILLVTGVALTSLKAKNERQSDNPEFKKAMGILIVSTVGYVGFVVLGDIFGVGG
    NCTC8325        IFGLIAMILLVTGVALTSLKAKNERQSDNPEFKKAMGILIVSTVGYVGFVVLGDIFGVGG
    Newman          IFGLIAMILLVTGVALTSLKAKNERQSDNPEFKKAMGILIVSTVGYVGFVVLGDIFGVGG
    USA300_FPR3757  IFGLIAMILLVTGVALTSLKAKNERQSDNPEFKKAMGILIVSTVGYVGFVVLGDIFGVGG
                    ************************************************************

    COL             TDALFFQSVGMAIGGFILSMNHKTSLKSTALNLLPGVIWGIGNLFMFYSQPKVGVATSFS
    N315            TDALFFQSVGMAIGGFILSMNHKTSLKSTALNLLPGVIWGIGNLFMFYSQPKVGVATSFS
    NCTC8325        TDALFFQSVGMAIGGFILSMNHKTSLKSTALNLLPGVIWGIGNLFMFYSQPKVGVATSFS
    Newman          TDALFFQSVGMAIGGFILSMNHKTSLKSTALNLLPGVIWGIGNLFMFYSQPKVGVATSFS
    USA300_FPR3757  TDALFFQSVGMAIGGFILSMNHKTSLKSTALNLLPGVIWGIGNLFMFYSQPKVGVATSFS
                    ************************************************************

    COL             LSQLLVIVSTLGGIFILGERKDRRQMTGIWAGIIIIVIAAIILGNLK
    N315            LSQLLVIVSTLGGIFILGERKDRRQMTGIWAGIIIIVIAAIILGNLK
    NCTC8325        LSQLLVIVSTLGGIFILGERKDRRQMTGIWAGIIIIVIAAIILGNLK
    Newman          LSQLLVIVSTLGGIFILGERKDRRQMTGIWAGIIIIVIAAIILGNLK
    USA300_FPR3757  LSQLLVIVSTLGGIFILGERKDRRQMTGIWAGIIIIVIAAIILGNLK
                    ***********************************************