From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005716000
  • symbol?:
  • description?: membrane protein
  • strand?: +
  • coordinates?: 5820475..5820979
  • synteny block?: BlockID0044620
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2198
    08BA02176:
    C248_2297
    11819-97:
    MS7_2280
    71193:
    ST398NM01_2312
    ECT-R 2:
    ECTR2_2122
    ED133:
    SAOV_2298
    ED98:
    SAAV_2322
    HO 5096 0412:
    SAEMRSA15_21580
    JH1:
    SaurJH1_2327
    JH9:
    SaurJH9_2286
    JKD6008:
    SAA6008_02297
    JKD6159:
    SAA6159_02166
    LGA251:
    SARLGA251_20450
    M013:
    M013TW_2218
    MRSA252:
    SAR2344
    MSHR1132:
    SAMSHR1132_20850
    MSSA476:
    SAS2150
    Mu3:
    SAHV_2244
    Mu50:
    SAV2260
    MW2:
    MW2178
    RF122:
    SAB2132
    ST398:
    SAPIG2312
    T0131:
    SAT0131_02433
    TCH60:
    HMPREF0772_10939
    TW20:
    SATW20_23930
    USA300_TCH1516:
    USA300HOU_2242
    VC40:
    SAVC_10165

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQFYLILLAILYLIVSFISIFKMEVVFTRILRIIMGVLLLFVLALTTMSFPKENWWVFIV
    N315            MQFYLILLAILYLIVSFISIFKMEVVFTRILRIIMGVLLLFVLALTTMSFPKENWWVFIV
    NCTC8325        MQFYLILLAILYLIVSFISIFKMEVVFTRILRIIMGVLLLFVLALTTMSFPKENWWVFIV
    Newman          MQFYLILLAILYLIVSFISIFKMEVVFTRILRIIMGVLLLFVLALTTMSFPKENWWVFIV
                    ************************************************************

    COL             LLLLVGNVEVTGFKMLKKDLKGVNILNLMSLFIFVIYFILTIVLF
    N315            LLLLVGNVEVTGFKMLKKDLKGVNILNLMSLFIFVIYFILTIVLF
    NCTC8325        LLLLVGNVEVTGFKMLKKDLKGVNILNLMSLFIFVIYFILTIVLF
    Newman          LLLLVGNVEVTGFKMLKKDLKGVNILNLMSLFIFVIYFILTIVLF
                    *********************************************