From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005718000
  • symbol?: fmhB
  • description?: FmhB protein

      descriptions from strain specific annotations:

    • FmhB protein
    • methicillin resistance protein
    • femX protein
    • FmhB protein of FemAB family involved in peptidoglycan interpeptide biosynthesis
    • femAB family protein
    • putative peptidoglycan pentaglycine interpeptide biosynthesis protein
    • peptidoglycan pentaglycine interpeptide biosynthesis protein FmhB
    • peptidoglycan pentaglycine interpeptide biosynthetic protein FmhB
    • Aminoacyltransferase femX
    • methicillin resistance factor peptidoglycan pentaglycine interpeptide biosynthetic protein
    • tRNA-dependent lipid II--glycine ligase (FmhB)
    • aminoacyltransferase FemX (Factor essential forexpression of methicillin resistance X)
    • UDP-N-acetylmuramoylpentapeptide-lysine N(6)-glycyltransferase
  • strand?: -
  • coordinates?: 5824462..5825727
  • synteny block?: BlockID0044640
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2253 (femX)
    N315:
    SA2057 (fmhB)
    NCTC8325:
    Newman:
    NWMN_2163 (fmhB)
    USA300_FPR3757:
    04-02981:
    SA2981_2200 (fmhB)
    08BA02176:
    C248_2299 (fmhB)
    11819-97:
    MS7_2282 (femX)
    71193:
    ST398NM01_2314
    ECT-R 2:
    ECTR2_2124
    ED133:
    SAOV_2300c
    ED98:
    SAAV_2326 (femX)
    HO 5096 0412:
    SAEMRSA15_21600 (fmhB)
    JH1:
    SaurJH1_2329
    JH9:
    SaurJH9_2288
    JKD6008:
    SAA6008_02299 (fmhB)
    JKD6159:
    SAA6159_02168 (fmhB)
    LGA251:
    SARLGA251_20470 (fmhB)
    M013:
    M013TW_2220
    MRSA252:
    SAR2346 (fmhB)
    MSHR1132:
    SAMSHR1132_20870
    MSSA476:
    SAS2152
    Mu3:
    SAHV_2246 (fmhB)
    Mu50:
    SAV2262 (fmhB)
    MW2:
    MW2180 (fmhB)
    RF122:
    SAB2134c (fmhB)
    ST398:
    SAPIG2314
    T0131:
    SAT0131_02437 (ctaA)
    TCH60:
    HMPREF0772_10937 (femX)
    TW20:
    SATW20_23950 (fmhB)
    USA300_TCH1516:
    USA300HOU_2244 (fmhB)
    VC40:
    SAVC_10175

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEKMHITNQEHDAFVKSHPNGDLLQLTKWAETKKLTGWYARRIAVGRDGEVQGVAQLLFK
    N315            MEKMHITNQEHDAFVKSHPNGDLLQLTKWAETKKLTGWYARRIAVGRDGEVQGVAQLLFK
    NCTC8325        MEKMHITNQEHDAFVKSHPNGDLLQLTKWAETKKLTGWYARRIAVGRDGEVQGVAQLLFK
    Newman          MEKMHITNQEHDAFVKSHPNGDLLQLTKWAETKKLTGWYARRIAVGRDGEVQGVAQLLFK
    USA300_FPR3757  MEKMHITNQEHDAFVKSHPNGDLLQLTKWAETKKLTGWYARRIAVGRDGEVQGVAQLLFK
                    ************************************************************

    COL             KVPKLPYTLCYISRGFVVDYSNKEALNALLDSAKEIAKAEKTYAIKIDPDVEVDKGTDAL
    N315            KVPKLPYTLCYISRGFVVDYSNKEALNALLDSAKEIAKAEKAYAIKIDPDVEVDKGTDAL
    NCTC8325        KVPKLPYTLCYISRGFVVDYSNKEALNALLDSAKEIAKAEKAYAIKIDPDVEVDKGTDAL
    Newman          KVPKLPYTLCYISRGFVVDYSNKEALNALLDSAKEIAKAEKAYAIKIDPDVEVDKGTDAL
    USA300_FPR3757  KVPKLPYTLCYISRGFVVDYSNKEALNALLDSAKEIAKAEKAYAIKIDPDVEVDKGTDAL
                    *****************************************:******************

    COL             QNLKALGFKHKGFKEGLSKDYIQPRMTMITPIDKNDDELLNSFERRNRSKVRLALKRGTT
    N315            QNLKALGFKHKGFKEGLSKDYIQPRMTMITPIDKNDDELLNSFERRNRSKVRLALKRGTT
    NCTC8325        QNLKALGFKHKGFKEGLSKDYIQPRMTMITPIDKNDDELLNSFERRNRSKVRLALKRGTT
    Newman          QNLKALGFKHKGFKEGLSKDYIQPRMTMITPIDKNDDELLNSFERRNRSKVRLALKRGTT
    USA300_FPR3757  QNLKALGFKHKGFKEGLSKDYIQPRMTMITPIDKNDDELLNSFERRNRSKVRLALKRGTT
                    ************************************************************

    COL             VERSDREGLKTFAELMKITGERDGFLTRDISYFENIYDALHEDGDAELFLVKLDPKENIA
    N315            VERSDREGLKTFAELMKITGERDGFLTRDISYFENIYDALHEDGDAELFLVKLDPKENIA
    NCTC8325        VERSDREGLKTFAELMKITGERDGFLTRDISYFENIYDALHEDGDAELFLVKLDPKENIA
    Newman          VERSDREGLKTFAELMKITGERDGFLTRDISYFENIYDALHEDGDAELFLVKLDPKENIA
    USA300_FPR3757  VERSDREGLKTFAELMKITGERDGFLTRDISYFENIYDALHEDGDAELFLVKLDPKENIA
                    ************************************************************

    COL             KVNQELNELHAEIAKWQQKMKTSEKQAKKAQNMINDAQNKIAKNEDLKRDLEALEKEHPE
    N315            KVNQELNELHAEIAKWQQKMETSEKQAKKAQNMINDAQNKIAKNEDLKRDLEALEKEHPE
    NCTC8325        KVNQELNELHAEIAKWQQKMKTSEKQAKKAQNMINDAQNKIAKNEDLKRDLEALEKEHPE
    Newman          KVNQELNELHAEIAKWQQKMKTSEKQAKKAQNMINDAQNKIAKNEDLKRDLEALEKEHPE
    USA300_FPR3757  KVNQELNELHAEIAKWQQKMKTSEKQAKKAQNMINDAQNKIAKNEDLKRDLEALEKEHPE
                    ********************:***************************************

    COL             GIYLSGALLMFAGSKSYYLYGASSNEFRDFLPNHHMQYTMMKYAREHGATTYDFGGTDND
    N315            GIYLSGALLMFAGSKSYYLYGASSNEFRDFLPNHHMQYTMMKYAREHGATTYDFGGTDND
    NCTC8325        GIYLSGALLMFAGSKSYYLYGASSNEFRDFLPNHHMQYTMMKYAREHGATTYDFGGTDND
    Newman          GIYLSGALLMFAGSKSYYLYGASSNEFRDFLPNHHMQYTMMKYAREHGATTYDFGGTDND
    USA300_FPR3757  GIYLSGALLMFAGSKSYYLYGASSNEFRDFLPNHHMQYTMMKYAREHGATTYDFGGTDND
                    ************************************************************

    COL             PDKDSEHYGLWAFKKVWGTYLSEKIGEFDYVLNQPLYQLIEQVKPRLTKAKIKISRKLKR
    N315            PDKDSEHYGLWAFKKVWGTYLSEKIGEFDYILNQPLYQLIEQVKPRLTKAKIKISRKLKR
    NCTC8325        PDKDSEHYGLWAFKKVWGTYLSEKIGEFDYVLNQPLYQLIEQVKPRLTKAKIKISRKLKR
    Newman          PDKDSEHYGLWAFKKVWGTYLSEKIGEFDYVLNQPLYQLIEQVKPRLTKAKIKISRKLKR
    USA300_FPR3757  PDKDSEHYGLWAFKKVWGTYLSEKIGEFDYVLNQPLYQLIEQVKPRLTKAKIKISRKLKR
                    ******************************:*****************************

    COL             K
    N315            K
    NCTC8325        K
    Newman          K
    USA300_FPR3757  K
                    *