From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005723000
  • symbol?:
  • description?: transporter ybfD

      descriptions from strain specific annotations:

    • transporter ybfD
    • major facilitator transporter
    • drug transporter, putative
    • Major facilitator family transporter
    • major facilitator superfamily protein
    • transporter protein
    • putative transporter protein
    • putative drug transporter
    • MFS family major facilitator transporter
    • major facilitator superfamily transporter
    • permease of the major facilitator superfamily
    • MFS superfamily transporter
    • membrane transporter
    • major facilitator superfamily protein (MFS)
  • strand?: +
  • coordinates?: 5827908..5828951
  • synteny block?: BlockID0044690
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2204
    08BA02176:
    C248_2303
    11819-97:
    MS7_2285
    71193:
    ST398NM01_2317
    ECT-R 2:
    ECTR2_2127
    ED133:
    SAOV_2304
    ED98:
    SAAV_2329
    HO 5096 0412:
    SAEMRSA15_21640
    JH1:
    SaurJH1_2333
    JH9:
    SaurJH9_2291
    JKD6008:
    SAA6008_02303
    JKD6159:
    SAA6159_02171
    LGA251:
    SARLGA251_20500
    M013:
    M013TW_2224
    MRSA252:
    SAR2350
    MSHR1132:
    SAMSHR1132_20910
    MSSA476:
    SAS2156
    Mu3:
    SAHV_2250
    Mu50:
    SAV2266
    MW2:
    MW2184
    RF122:
    SAB2138
    ST398:
    SAPIG2317
    T0131:
    SAT0131_02442
    TCH60:
    HMPREF0772_10934
    TW20:
    SATW20_23980
    USA300_TCH1516:
    USA300HOU_2247
    VC40:
    SAVC_10190

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTNQGSLNKSPIFTKSFTINFLVNFIVYLCMYLLLVVIAGYSKQAFDASDSLAGLVVGLF
    N315            MTNQGSLNKSPIFTKSFTINFFVNFIVYLCMYLLLVVIAGYSKQAFDASDSLAGLVVGLF
    NCTC8325        MTNQGSLNKSPIFTKSFTINFLVNFIVYLCMYLLLVVIAGYSKQAFDASDSLAGLVVGLF
    Newman          MTNQGSLNKSPIFTKSFTINFLVNFIVYLCMYLLLVVIAGYSKQAFDASDSLAGLVVGLF
    USA300_FPR3757  MTNQGSLNKSPIFTKSFTINFLVNFIVYLCMYLLLVVIAGYSKQAFDASDSLAGLVVGLF
                    *********************:**************************************

    COL             IVGSLIGRFATGKFVNQIGPKRLLFIGLIALIITQLLYFIDGSLAFLIFVRLINGIATAV
    N315            IVGSLIGRFATGKFVNQIGPKRLLFIGLIALIITQLLYFIDGSLAFLIFVRLINGIATAV
    NCTC8325        IVGSLIGRFATGKFVNQIGPKRLLFIGLIALIITQLLYFIDGSLAFLIFVRLINGIATAV
    Newman          IVGSLIGRFATGKFVNQIGPKRLLFIGLIALIITQLLYFIDGSLAFLIFVRLINGIATAV
    USA300_FPR3757  IVGSLIGRFATGKFVNQIGPKRLLFIGLIALIITQLLYFIDGSLAFLIFVRLINGIATAV
                    ************************************************************

    COL             VTTATGTIAAYVTPVNRKSEGISLFSLSLVLGTAIGPFLGMLLITKYAIDLLFIICVILG
    N315            VTTATGTIAAYVTPVNRKSEGISLFSLSLVLGTAIGPFLGMLLITKYAIDLLFIICVILG
    NCTC8325        VTTATGTIAAYVTPVNRKSEGISLFSLSLVLGTAIGPFLGMLLITKYAIDLLFIICVILG
    Newman          VTTATGTIAAYVTPVNRKSEGISLFSLSLVLGTAIGPFLGMLLITKYAIDLLFIICVILG
    USA300_FPR3757  VTTATGTIAAYVTPVNRKSEGISLFSLSLVLGTAIGPFLGMLLITKYAIDLLFIICVILG
                    ************************************************************

    COL             ILGLIISLFIKVDFEVTNNKTETNVIDKPRFSIHQFIAKEAIPVAVIMLLIGVTYASILT
    N315            ILGLIISLFIKVDFEVTNNKTETDVINKPRFSIHQFIAKEAIPVAVIMLLIGVTYASILT
    NCTC8325        ILGLIISLFIKVDFEVTNNKTETNVIDKPRFSIHQFIAKEAIPVAVIMLLIGVTYASILT
    Newman          ILGLIISLFIKVDFEVTNNKTETNVIDKPRFSIHQFIAKEAIPVAVIMLLIGVTYASILT
    USA300_FPR3757  ILGLIISLFIKVDFEVTNNKTETNVIDKPRFSIHQFIAKEAIPVAVIMLLIGVTYASILT
                    ***********************:**:*********************************

    COL             YLQAFALERHLVTAASYFFICYAIASLITRPIAGRLMDDKNENIIVYPAFIMLFLSFVCL
    N315            YLQAFALERHLVTAASYFFICYAIASLITRPIAGRLMDDKNENIIVYPAFIMLFLSFVCL
    NCTC8325        YLQAFALERHLVTAASYFFICYAIASLITRPIAGRLMDDKNENIIVYPAFIMLFLSFVCL
    Newman          YLQAFALERHLVTAASYFFICYAIASLITRPIAGRLMDDKNENIIVYPAFIMLFLSFVCL
    USA300_FPR3757  YLQAFALERHLVTAASYFFICYAIASLITRPIAGRLMDDKNENIIVYPAFIMLFLSFVCL
                    ************************************************************

    COL             ISSYQSWLILLAGACLGLGYGNLSSAMQSIAIKVSPPIKYGIATSTFYVGLDAGVGFGPS
    N315            ISSYQSWLILLAGACLGLGYGNLSSAMQSIAIKVSPPIKYGIATSTFYVGLDAGVGFGPS
    NCTC8325        ISSYQSWLILLAGACLGLGYGNLSSAMQSIAIKVSPPIKYGIATSTFYVGLDAGVGFGPS
    Newman          ISSYQSWLILLAGACLGLGYGNLSSAMQSIAIKVSPPIKYGIATSTFYVGLDAGVGFGPS
    USA300_FPR3757  ISSYQSWLILLAGACLGLGYGNLSSAMQSIAIKVSPPIKYGIATSTFYVGLDAGVGFGPS
                    ************************************************************

    COL             FLGLFTHMFSYSEIFGFMAALAIITMLVYFLIHGRHVTRNAMN
    N315            FLGLFTHMFSYSEIFGFMAALAIITMLVYFLIHGRHVTRNAMN
    NCTC8325        FLGLFTHMFSYSEIFGFMAALAIITMLVYFLIHGRHVTRNAMN
    Newman          FLGLFTHMFSYSEIFGFMAALAIITMLVYFLIHGRHVTRNAMN
    USA300_FPR3757  FLGLFTHMFSYSEIFGFMAALAIITMLVYFLIHGRHVTRNAMN
                    *******************************************