From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005724000
  • symbol?: sarV
  • description?: SarA family transcriptional regulator

      descriptions from strain specific annotations:

    • SarA family transcriptional regulator
    • accessory regulator A-like protein
    • HTH-type transcriptional regulator SarV (Staphylococcal accessoryregulator V)
    • Transcriptional regulator SarV
    • staphylococcal accessory regulator V
    • marR family protein
    • HTH-type transcriptional regulator sarV
    • staphylococcal accessory regulator family
  • strand?: -
  • coordinates?: 5829224..5829574
  • synteny block?: BlockID0044700
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2258 (sarV)
    N315:
    NCTC8325:
    Newman:
    NWMN_2167 (sarV)
    USA300_FPR3757:
    04-02981:
    SA2981_2205 (sarV)
    08BA02176:
    C248_2304
    11819-97:
    MS7_2286 (sarV)
    71193:
    ST398NM01_2318
    ECT-R 2:
    ECTR2_2128
    ED133:
    SAOV_2305c
    ED98:
    SAAV_2330 (sarV)
    HO 5096 0412:
    SAEMRSA15_21650
    JH1:
    SaurJH1_2334
    JH9:
    SaurJH9_2292
    JKD6008:
    SAA6008_02304 (sarV)
    JKD6159:
    SAA6159_02172 (sarV)
    LGA251:
    SARLGA251_20510 (sarV)
    M013:
    M013TW_2225
    MRSA252:
    SAR2351
    MSHR1132:
    SAMSHR1132_20920
    MSSA476:
    SAS2157
    Mu3:
    SAHV_2251
    Mu50:
    SAV2267
    MW2:
    MW2185
    RF122:
    SAB2139c
    ST398:
    SAPIG2318
    T0131:
    SAT0131_02443
    TCH60:
    HMPREF0772_10933 (sarV)
    TW20:
    SATW20_23990 (sarV)
    USA300_TCH1516:
    USA300HOU_2248
    VC40:
    SAVC_10195

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSNKVQRFIEAERELSQLKHWLKTTHKISIEEFVVLFKVYEAEKISGKELRDTLHFEMLW
    N315            MSNKVQRFIEAERELSQLKHWLKTTHKISIEEFVVLFKVYEAEKISGKELRDTLHFEMLW
    NCTC8325        MSNKVQRFIEAERELSQLKHWLKTTHKISIEEFVVLFKVYEAEKISGKELRDTLHFEMLW
    Newman          MSNKVQRFIEAERELSQLKHWLKTTHKISIEEFVVLFKVYEAEKISGKELRDTLHFEMLW
    USA300_FPR3757  MSNKVQRFIEAERELSQLKHWLKTTHKISIEEFVVLFKVYEAEKISGKELRDTLHFEMLW
                    ************************************************************

    COL             DTSKIDVIIRKIYKKELISKLRSETDERQVFYFYSTSQKKLLDKITKEIEVLSVTN
    N315            DTSKIDVIIRKIYKKELISKLRSETDERQVFYFYSTSQKKLLDKITKEIEVLSVTN
    NCTC8325        DTSKIDVIIRKIYKKELISKLRSETDERQVFYFYSTSQKKLLDKITKEIEVLSVTN
    Newman          DTSKIDVIIRKIYKKELISKLRSETDERQVFYFYSTSQKKLLDKITKEIEVLSVTN
    USA300_FPR3757  DTSKIDVIIRKIYKKELISKLRSETDERQVFYFYSTSQKKLLDKITKEIEVLSVTN
                    ********************************************************