From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005730000
  • symbol?: mobA
  • description?: molybdopterin-guanine dinucleotide biosynthesis protein MobA

      descriptions from strain specific annotations:

    • molybdopterin-guanine dinucleotide biosynthesis protein MobA
    • molybdopterin-guanine dinucleotide biosynthesis protein A
    • molybdopterin-guanine dinucleotide biosynthesis mobA
    • putative molybdopterin-guanine dinucleotidebiosynthesis protein A
  • strand?: -
  • coordinates?: 5831882..5832481
  • synteny block?: BlockID0044760
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2262 (mobA)
    N315:
    SA2064 (mobA)
    NCTC8325:
    Newman:
    NWMN_2169 (mobA)
    USA300_FPR3757:
    04-02981:
    SA2981_2207 (mobA)
    08BA02176:
    C248_2307 (mobA)
    11819-97:
    MS7_2288 (mobA)
    71193:
    ST398NM01_2320
    ECT-R 2:
    ECTR2_2130
    ED133:
    SAOV_2308c
    ED98:
    SAAV_2332 (mobA)
    HO 5096 0412:
    SAEMRSA15_21670 (mobA)
    JH1:
    SaurJH1_2336 (mobA)
    JH9:
    SaurJH9_2294 (mobA)
    JKD6008:
    SAA6008_02306 (mobA)
    JKD6159:
    SAA6159_02174 (mobA)
    LGA251:
    SARLGA251_20530 (mobA)
    M013:
    M013TW_2227
    MRSA252:
    SAR2353 (mobA)
    MSHR1132:
    SAMSHR1132_20940
    MSSA476:
    SAS2159 (mobA)
    Mu3:
    SAHV_2253 (mobA)
    Mu50:
    SAV2269 (mobA)
    MW2:
    MW2187 (mobA)
    RF122:
    SAB2141c (mobA)
    ST398:
    SAPIG2320
    T0131:
    SAT0131_02446
    TCH60:
    HMPREF0772_10929 (mobA)
    TW20:
    SATW20_24010 (mobA)
    USA300_TCH1516:
    USA300HOU_2251 (mobA)
    VC40:
    SAVC_10210 (mobA)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKAIILAGGHSVRFGKPKAFAEVNGETFYSRVIKTLESTNMFNEIIISTNAQLATQFKYP
    N315            MKAIILAGGHSVRFGKPKAFAEVNGETFYSRVIKTLESTNMFNEIIISTNAQLATQFKYP
    NCTC8325        MKAIILAGGHSVRFGKPKAFAEVNGETFYSRVIKTLESTNMFNEIIISTNAQLATQFKYP
    Newman          MKAIILAGGHSVRFGKPKAFAEVNGETFYSRVIKTLESTNMFNEIIISTNAQLATQFKYP
    USA300_FPR3757  MKAIILAGGHSVRFGKPKAFAEVNGETFYSRVIKTLESTNMFNEIIISTNAQLATQFKYP
                    ************************************************************

    COL             NVVIDDENHNDKGPLAGIYTIMKQHPEEELFFVVSVDTPMITGKAVSTLYQFLVSHLIEN
    N315            NVVIDDENHNDKGPLAGIYTIMKQHPEEELFFVVSVDTPMITGKAVSTLYQFLVSHLIEN
    NCTC8325        NVVIDDENHNDKGPLAGIYTIMKQHPEEELFFVVSVDTPMITGKAVSTLYQFLVSHLIEN
    Newman          NVVIDDENHNDKGPLAGIYTIMKQHPEEELFFVVSVDTPMITGKAVSTLYQFLVSHLIEN
    USA300_FPR3757  NVVIDDENHNDKGPLAGIYTIMKQHPEEELFFVVSVDTPMITGKAVSTLYQFLVSHLIEN
                    ************************************************************

    COL             HLDVAAFKEDGRFIPTIAFYSPNALGAITKALHSDNYSFKNVYHELSTDYLDVRDVDAPS
    N315            HLDVAAFKEDGRFIPTIAFYSPNALGAITKALHSDNYSFKNIYHELSTDYLDVRDVDAPS
    NCTC8325        HLDVAAFKEDGRFIPTIAFYSPNALGAITKALHSDNYSFKNVYHELSTDYLDVRDVDAPS
    Newman          HLDVAAFKEDGRFIPTIAFYSPNALGAITKALHSDNYSFKNVYHELSTDYLDVRDVDAPS
    USA300_FPR3757  HLDVAAFKEDGRFIPTIAFYSPNALGAITKALHSDNYSFKNVYHELSTDYLDVRDVDAPS
                    *****************************************:******************

    COL             YWYKNINYQHDLDALIQKL
    N315            YWYKNINYQHDLDALIQKL
    NCTC8325        YWYKNINYQHDLDALIQKL
    Newman          YWYKNINYQHDLDALIQKL
    USA300_FPR3757  YWYKNINYQHDLDALIQKL
                    *******************