From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005734000
  • symbol?: moeA
  • description?: molybdopterin biosynthesis protein

      descriptions from strain specific annotations:

    • molybdopterin biosynthesis protein
    • molybdenum cofactor synthesis domain-containing protein
    • Molybdopterin biosynthesis protein A
    • molybdopterin biosynthesis protein moeA
    • molybdopterin biosynthesis MoeA protein, putative
    • putative molybdenum cofactor biosynthesis protein
    • Molybdopterin molybdenum transferase
    • Molybdopterin biosynthesis MoeA protein
  • strand?: -
  • coordinates?: 5833669..5834928
  • synteny block?: BlockID0044800
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA2068 (moeA)
    NCTC8325:
    Newman:
    NWMN_2173 (moeA)
    USA300_FPR3757:
    04-02981:
    SA2981_2211 (moeA)
    08BA02176:
    C248_2311 (moeA)
    11819-97:
    MS7_2292 (moeA)
    71193:
    ST398NM01_2324
    ECT-R 2:
    ECTR2_2134
    ED133:
    SAOV_2312c
    ED98:
    SAAV_2336
    HO 5096 0412:
    SAEMRSA15_21710 (moeA)
    JH1:
    SaurJH1_2340
    JH9:
    SaurJH9_2298
    JKD6008:
    SAA6008_02310 (moeA)
    JKD6159:
    SAA6159_02178 (moeA)
    LGA251:
    SARLGA251_20570 (moeA)
    M013:
    M013TW_2231
    MRSA252:
    SAR2357 (moeA)
    MSHR1132:
    SAMSHR1132_20980
    MSSA476:
    SAS2163
    Mu3:
    SAHV_2257 (moeA)
    Mu50:
    SAV2273 (moeA)
    MW2:
    MW2191 (moeA)
    RF122:
    SAB2145c (moeA)
    ST398:
    SAPIG2324
    T0131:
    SAT0131_02451
    TCH60:
    HMPREF0772_10925 (moeA)
    TW20:
    SATW20_24050 (moeA)
    USA300_TCH1516:
    USA300HOU_2255 (moeA)
    VC40:
    SAVC_10230

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVVEKRNPIPVKEAIQRIVNQQSSMPAITVALEKSLNHILAEDIVATYDIPRFDKSPYDG
    N315            MVVEKRNPIPVKEAIQRIVNQQSSMPAITVALEKSLNHILAEDIVATYDIPRFDKSPYDG
    NCTC8325        MVVEKRNPIPVKEAIQRIVNQQSSMPAITVALEKSLNHILAEDIVATYDIPRFDKSPYDG
    Newman          MVVEKRNPIPVKEAIQRIVNQQSSMPAITVALEKSLNHILAEDIVATYDIPRFDKSPYDG
    USA300_FPR3757  MVVEKRNPIPVKEAIQRIVNQQSSMPAITVALEKSLNHILAEDIVATYDIPRFDKSPYDG
                    ************************************************************

    COL             FAIRSVDSQGASGQNRIEFKVIDHIGAGSVSDKLVGDHEAVRIMTGAQIPNGADAVVMFE
    N315            FAIRSVDSQGASGQNRIEFKVIDHIGAGSVSDKLVGDHEAVRIMTGAQIPNGADAVVMFE
    NCTC8325        FAIRSVDSQGASGQNRIEFKVIDHIGAGSVSDKLVGDHEAVRIMTGAQIPNGADAVVMFE
    Newman          FAIRSVDSQGASGQNRIEFKVIDHIGAGSVSDKLVGDHEAVRIMTGAQIPNGADAVVMFE
    USA300_FPR3757  FAIRSVDSQGASGQNRIEFKVIDHIGAGSVSDKLVGDHEAVRIMTGAQIPNGADAVVMFE
                    ************************************************************

    COL             QTIELEDTFTIRKPFSKNENISLKGEETKTGDVVLKKGQVINPGAIAVLATYGYAEVKVI
    N315            QTIELEDTFTIRKPFSKNENISLKGEETKTGDVVLKKGQVINPGAIAVLATYGYAEVKVI
    NCTC8325        QTIELEDTFTIRKPFSKNENISLKGEETKTGDVVLKKGQVINPGAIAVLATYGYAEVKVI
    Newman          QTIELEDTFTIRKPFSKNENISLKGEETKTGDVVLKKGQVINPGAIAVLATYGYAEVKVI
    USA300_FPR3757  QTIELEDTFTIRKPFSKNENISLKGEETKTGDVVLKKGQVINPGAIAVLATYGYAEVKVI
                    ************************************************************

    COL             KQPSVAVIATGSELLDVNDVLEDGKIRNSNGPMIRALAEKLGLEVGIYKTQKDDLDSGIQ
    N315            KQPSVAVIATGSELLDVNDVLEDGKIRNSNGPMIRALAEKLGLEVGIYKTQKDDLDSGIQ
    NCTC8325        KQPSVAVIATGSELLDVNDVLEDGKIRNSNGPMIRALAEKLGLEVGIYKTQKDDLDSGIQ
    Newman          KQPSVAVIATGSELLDVNDVLEDGKIRNSNGPMIRALAEKLGLEVGIYKTQKDDLDSGIQ
    USA300_FPR3757  KQPSVAVIATGSELLDVNDVLEDGKIRNSNGPMIRALAEKLGLEVGIYKTQKDDLDSGIQ
                    ************************************************************

    COL             VVKEAMEKHDIVITTGGVSVGDFDYLPEIYKAVKAEVLFNKVAMRPGSVTTVAFVDGKYL
    N315            VVKEAMEKHDIVITTGGVSVGDFDYLPEIYKAVKAEVLFNKVAMRPGSVTTVAFADGKYL
    NCTC8325        VVKEAMEKHDIVITTGGVSVGDFDYLPEIYKAVKAEVLFNKVAMRPGSVTTVAFVDGKYL
    Newman          VVKEAMEKHDIVITTGGVSVGDFDYLPEIYKAVKAEVLFNKVAMRPGSVTTVAFVDGKYL
    USA300_FPR3757  VVKEAMEKHDIVITTGGVSVGDFDYLPEIYKAVKAEVLFNKVAMRPGSVTTVAFVDGKYL
                    ******************************************************.*****

    COL             FGLSGNPSACFTGFELFVKPAVKHMCGALEVFPQIIKATLMEDFTKANPFTRFIRAKATL
    N315            FGLSGNPSACFTGFELFVKPAVKHMCGALEVFPQIIKATLMEDFTKANPFTRFIRAKATL
    NCTC8325        FGLSGNPSACFTGFELFVKPAVKHMCGALEVFPQIIKATLMEDFTKANPFTRFIRAKATL
    Newman          FGLSGNPSACFTGFELFVKPAVKHMCGALEVFPQIIKATLMEDFTKANPFTRFIRAKATL
    USA300_FPR3757  FGLSGNPSACFTGFELFVKPAVKHMCGALEVFPQIIKATLMEDFTKANPFTRFIRAKATL
                    ************************************************************

    COL             TSAGATVVPSGFNKSGAVVAIAHANCMVMLPGGSRGFKAGHTVDIILTESDAAEEELLL
    N315            TSAGATVVPSGFNKSGAVVAIAHANCMVMLPGGSRGFKAGHTVDIILTESDAAEEELLL
    NCTC8325        TSAGATVVPSGFNKSGAVVAIAHANCMVMLPGGSRGFKAGHTVDIILTESDAAEEELLL
    Newman          TSAGATVVPSGFNKSGAVVAIAHANCMVMLPGGSRGFKAGHTVDIILTESDAAEEELLL
    USA300_FPR3757  TSAGATVVPSGFNKSGAVVAIAHANCMVMLPGGSRGFKAGHTVDIILTESDAAEEELLL
                    ***********************************************************