Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005740000
  • symbol?: modA
  • description?: molybdate-binding protein

      descriptions from strain specific annotations:

    • molybdate-binding protein
    • molybdate-binding lipoprotein precursor
    • molybdenum ABC transporter, periplasmic molybdate-binding protein
    • molybdenum ABC transporter periplasmic molybdate-binding protein
    • Molybdenum ABC transporter, periplasmic molybdenum-binding protein modA
    • molybdate ABC transporter periplasmic molybdate-binding protein
    • molybdenum (Mo2+) ABC superfamily ATP binding cassette transporter, binding protein
    • putative molybdate-binding lipoprotein precursor
    • molybdate ABC superfamily ATP binding cassette transporter, binding protein
    • molybdate ABC transporter, periplasmic molybdate-binding protein
    • molybdenum ABC transporter molybdenum-binding protein ModA
    • molybdenum ABC transporter ATP-binding protein
    • truncated molybdenum ABC transporter molybdenum-binding protein ModA
    • periplasmic molybdenum-binding protein ModA
  • strand?: -
  • coordinates?: 5838497..5839279
  • synteny block?: BlockID0044860
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2272 (modA)
    N315:
    SA2074 (modA)
    NCTC8325:
    Newman:
    NWMN_2179 (modA)
    USA300_FPR3757:
    04-02981:
    SA2981_2217 (modA)
    08BA02176:
    C248_2317 (modA)
    11819-97:
    MS7_2298 (modA)
    71193:
    ST398NM01_2330
    ECT-R 2:
    ECTR2_2140 (modA)
    ED133:
    SAOV_2318c
    ED98:
    SAAV_2342 (modA)
    HO 5096 0412:
    SAEMRSA15_21770 (modA)
    JH1:
    SaurJH1_2346
    JH9:
    SaurJH9_2304
    JKD6008:
    SAA6008_02316 (modA)
    JKD6159:
    SAA6159_02184 (modA)
    LGA251:
    SARLGA251_20630 (modA)
    M013:
    M013TW_2237
    MRSA252:
    SAR2363 (modA)
    MSHR1132:
    SAMSHR1132_21040
    MSSA476:
    SAS2169
    Mu3:
    SAHV_2263 (modA)
    Mu50:
    SAV2279 (modA)
    MW2:
    MW2197 (modA)
    RF122:
    SAB2151c (modA)
    ST398:
    SAPIG2330 (modA)
    T0131:
    SAT0131_02457 (isdC)
    TCH60:
    HMPREF0772_10919 (modA)
    TW20:
    SATW20_24110 (modA)
    USA300_TCH1516:
    USA300HOU_2261 (modA)
    VC40:
    SAVC_10260

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKLKRLFAVVIAMLLVLAGCSNSNDNNESKKDDADNGKKQEIQVAAAASLTDVTKKLASE
    N315            MKMKRFIAIVMALFLVLAGCSNSNDNNESKKDDADNGKKQEIQVAAAASLTDVTKKLASE
    NCTC8325        MKLKRLFAVVIAMLLVLAGCSNSNDNNESKKDDADNGKKQEIQVAAAASLTDVTKKLASE
    Newman          MKLKRLFAVVIAMLLVLAGCSNSNDNNESKKDDADNGKKQEIQVAAAASLTDVTKKLASE
    USA300_FPR3757  MKLKRLFAVVIAMLLVLAGCSNSNDNNESKKDDADNGKKQEIQVAAAASLTDVTKKLASE
                    **:**::*:*:*::**********************************************

    COL             FKKEHKNADIKFNYGGSGALRKQIESGAPVDVFMSANTKDVDALKDKNKAHDTYKYAKNS
    N315            FKKEHKNADIKFNYGGSGALRKQIESGAPVDVFMSANTKDVDALKDKNKAHDTYKYAKNS
    NCTC8325        FKKEHKNADIKFNYGGSGALRKQIESGAPVDVFMSANTKDVDALKDKNKAHDTYKYAKNS
    Newman          FKKEHKNADIKFNYGGSGALRKQIESGAPVDVFMSANTKDVDALKDKNKAHDTYKYAKNS
    USA300_FPR3757  FKKEHKNADIKFNYGGSGALRKQIESGAPVDVFMSANTKDVDALKDKNKAHDTYKYAKNS
                    ************************************************************

    COL             LVLIGDKDSNYTSVKDLKDNDKLALGEVKTVPAGKYAKQYLDNNNLFKEVESKIVYAKDV
    N315            LVLIGDKDSNYTSVKDLKDNDKLALGEVKTVPAGKYAKQYLDNNNLFKEVESKIVYAKDV
    NCTC8325        LVLIGDKDSNYTSVKDLKDNDKLALGEVKTVPAGKYAKQYLDNNNLFKEVESKIVYAKDV
    Newman          LVLIGDKDSNYTSVKDLKDNDKLALGEVKTVPAGKYAKQYLDNNNLFKEVESKIVYAKDV
    USA300_FPR3757  LVLIGDKDSNYTSVKDLKDNDKLALGEVKTVPAGKYAKQYLDNNNLFKEVESKIVYAKDV
                    ************************************************************

    COL             KQVLNYVEKGNAKQGFVYKTDLYKQNKKIDTVKVIKEVELKKPITYEAGATSDSKLAKEW
    N315            KQVLNYVEKGNAKQGFVYKTDLYKQNKKIDTVKVIKEVELKKPITYEAGATSDSKLAKEW
    NCTC8325        KQVLNYVEKGNAKQGFVYKTDLYKQNKKIDTVKVIKEVELKKPITYEAGATSDSKLAKEW
    Newman          KQVLNYVEKGNAKQGFVYKTDLYKQNKKIDTVKVIKEVELKKPITYEAGATSDSKLAKEW
    USA300_FPR3757  KQVLNYVEKGNAKQGFVYKTDLYKQNKKIDTVKVIKEVELKKPITYEAGATSDSKLAKEW
                    ************************************************************

    COL             MEFLKSDKAKEILKEYHFAA
    N315            MEFLKSDKAKEILKEYHFAA
    NCTC8325        MEFLKSDKAKEILKEYHFAA
    Newman          MEFLKSDKAKEILKEYHFAA
    USA300_FPR3757  MEFLKSDKAKEILKEYHFAA
                    ********************