From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005741000
  • symbol?: fdhD
  • description?: formate dehydrogenase accessory protein

      descriptions from strain specific annotations:

    • formate dehydrogenase accessory protein
    • Formate dehydrogenase chain D
    • formate dehydrogenase family accessory protein FdhD
    • FdhD/NarQ family protein
    • Protein fdhD -like protein
    • formate dehydrogenase -like protein
  • strand?: +
  • coordinates?: 5839571..5840368
  • synteny block?: BlockID0044870
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2273 (fdhD)
    N315:
    SA2075 (FdhD)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2218 (narQ)
    08BA02176:
    C248_2318
    11819-97:
    MS7_2299
    71193:
    ST398NM01_2331
    ECT-R 2:
    ECTR2_2141 (fdhD)
    ED133:
    SAOV_2319
    ED98:
    SAAV_2343 (fdhD)
    HO 5096 0412:
    SAEMRSA15_21780
    JH1:
    SaurJH1_2347
    JH9:
    SaurJH9_2305
    JKD6008:
    SAA6008_02317 (fdhD)
    JKD6159:
    SAA6159_02185 (fdhD)
    LGA251:
    SARLGA251_20640
    M013:
    M013TW_2238
    MRSA252:
    SAR2364
    MSHR1132:
    SAMSHR1132_21050
    MSSA476:
    SAS2170
    Mu3:
    SAHV_2264 (narQ)
    Mu50:
    SAV2280 (narQ)
    MW2:
    MW2198 (narQ)
    RF122:
    SAB2152
    ST398:
    SAPIG2331 (fdhD)
    T0131:
    SAT0131_02458
    TCH60:
    HMPREF0772_10918 (fdhD)
    TW20:
    SATW20_24120
    USA300_TCH1516:
    USA300HOU_2262 (fdhD)
    VC40:
    SAVC_10265

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKDVSLGQPIVRYEDGKLFNTTDQYVTEFPLTIMVNGEEFATVICSPTNLEELVIGFLA
    N315            MNKDVSLGQPIVRYEDGKLFNTTDQYVTEFPLTIMVNGEEFATVICSPTNLEELVIGFLA
    NCTC8325        MNKDVSLGQPIVRYEDGKLFNTTDQYVTEFPLTIMVNGEEFATVICSPTNLEELVIGFLA
    Newman          MNKDVSLGQPIVRYEDGKLFNTTDQYVTEFPLTIMVNGEEFATVICSPTNLEELVIGFLA
    USA300_FPR3757  MNKDVSLGQPIVRYEDGKLFNTTDQYVTEFPLTIMVNGEEFATVICSPTNLEELVIGFLA
                    ************************************************************

    COL             SEGAILKRDELKSVLIDDSKGFAHVELNKDLGDRFQYSTKRMIASCCGKSREFYFQNDAA
    N315            SEGAILKRDELKSVLIDDSKGFAHVELNKDLGDRFQYSTKRMIASCCGKSREFYFQNDAA
    NCTC8325        SEGAILKRDELKSVLIDDSKGFAHVELNKDLGDRFQYSTKRMIASCCGKSREFYFQNDAA
    Newman          SEGAILKRDELKSVLIDDSKGFAHVELNKDLGDRFQYSTKRMIASCCGKSREFYFQNDAA
    USA300_FPR3757  SEGAILKRDELKSVLIDDSKGFAHVELNKDLGDRFQYSTKRMIASCCGKSREFYFQNDAA
                    ************************************************************

    COL             IAKTSMSKITLTPMQIINMMTRLQSASHIYQETGGLHNAAISDGLTFFVHRQDIGRHNAL
    N315            IAKTSMSKITLTPIQIINMMTRLQSASHIYQETGGLHNAAISDGLTFFVHRQDIGRHNAL
    NCTC8325        IAKTSMSKITLTPMQIINMMTRLQSASHIYQETGGLHNAAISDGLTFFVHRQDIGRHNAL
    Newman          IAKTSMSKITLTPMQIINMMTRLQSASHIYQETGGLHNAAISDGLTFFVHRQDIGRHNAL
    USA300_FPR3757  IAKTSMSKITLTPMQIINMMTRLQSASHIYQETGGLHNAAISDGLTFFVHRQDIGRHNAL
                    *************:**********************************************

    COL             DKLYGFCIQRHITVRDKVLIFSGRISSEILIKAAKIGVGVILSKSAPTTLAVTLANDLNI
    N315            DKLYGFCIQRHITVRDKVLIFSGRISSEILIKAAKIGVGVILSKSAPTTLAVTLANDLNI
    NCTC8325        DKLYGFCIQRHITVRDKVLIFSGRISSEILIKAAKIGVGVILSKSAPTTLAVTLANDLNI
    Newman          DKLYGFCIQRHITVRDKVLIFSGRISSEILIKAAKIGVGVILSKSAPTTLAVTLANDLNI
    USA300_FPR3757  DKLYGFCIQRHITVRDKVLIFSGRISSEILIKAAKIGVGVILSKSAPTTLAVTLANDLNI
                    ************************************************************

    COL             TAVGFIRNGGFNIYSHPERIIDSEQ
    N315            TAVGFIRNGGFNIYSHPERIIDSEQ
    NCTC8325        TAVGFIRNGGFNIYSHPERIIDSEQ
    Newman          TAVGFIRNGGFNIYSHPERIIDSEQ
    USA300_FPR3757  TAVGFIRNGGFNIYSHPERIIDSEQ
                    *************************