From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005745000
  • symbol?:
  • description?: purine nucleosidase

      descriptions from strain specific annotations:

    • purine nucleosidase
    • inosine-uridine preferring nucleoside hydrolase
    • inosine-uridine preferring nucleoside hydrolase family protein
    • putative inosine-uridine preferring nucleosidehydrolase
    • inosine/uridine-preferring nucleoside hydrolase
    • inosine-adenosine-guanosine-nucleoside hydrolase
  • strand?: -
  • coordinates?: 5843060..5843929
  • synteny block?: BlockID0044910
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2221
    08BA02176:
    C248_2321
    11819-97:
    MS7_2302
    71193:
    ST398NM01_2334
    ECT-R 2:
    ECTR2_2144
    ED133:
    SAOV_2322c
    ED98:
    SAAV_2346
    HO 5096 0412:
    SAEMRSA15_21810
    JH1:
    SaurJH1_2350
    JH9:
    SaurJH9_2308
    JKD6008:
    SAA6008_02320
    JKD6159:
    SAA6159_02188
    LGA251:
    SARLGA251_20670
    M013:
    M013TW_2241
    MRSA252:
    SAR2367
    MSHR1132:
    SAMSHR1132_21090
    MSSA476:
    SAS2173
    Mu3:
    SAHV_2267
    Mu50:
    SAV2283
    MW2:
    MW2201
    RF122:
    SAB2155c
    ST398:
    SAPIG2334
    T0131:
    SAT0131_02461 (isdF)
    TCH60:
    HMPREF0772_10915
    TW20:
    SATW20_24150
    USA300_TCH1516:
    USA300HOU_2265
    VC40:
    SAVC_10280

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKKVYFNHDGGVDDLVSLFLLLQMENVQLIGVSTIGADCYLEPSLSASVKIINRFSNED
    N315            MTKKVYFNHDGGVDDLVSLFLLLQMENVQLIGVSTIGADCYLEPSLSASVKIINRFSNED
    NCTC8325        MTKKVYFNHDGGVDDLVSLFLLLQMENVQLIGVSTIGADCYLEPSLSASVKIINRFSNED
    Newman          MTKKVYFNHDGGVDDLVSLFLLLQMENVQLIGVSTIGADCYLEPSLSASVKIINRFSNED
    USA300_FPR3757  MTKKVYFNHDGGVDDLVSLFLLLQMENVQLIGVSTIGADCYLEPSLSASVKIINRFSNED
                    ************************************************************

    COL             IQVAPSYERGKNPFPKEWRMHAFFMDALPILNEPVKHVASNVSDKEAFEDIIQTLKRQSE
    N315            IQVAPSYERGKNPFPKEWRMHAFFMDALPILNEPVKHVASNVSDKEAFEDIIQTLKRQSE
    NCTC8325        IQVAPSYERGKNPFPKEWRMHAFFMDALPILNEPVKHVASNVSDKEAFEDIIQTLKRQSE
    Newman          IQVAPSYERGKNPFPKEWRMHAFFMDALPILNEPVKHVASNVSDKEAFEDIIQTLKRQSE
    USA300_FPR3757  IQVAPSYERGKNPFPKEWRMHAFFMDALPILNEPVKHVASNVSDKEAFEDIIQTLKRQSE
                    ************************************************************

    COL             KVTLLFTGPLTDLAKALQKDSSIVQYIEKLVWMGGTFLPKGNVEEPEHDGSAEWNAYWDP
    N315            KVTLLFTGPLTDLAKALQKDSSIVQYIEKLVWMGGTFLPKGNVEEPEHDGSAEWNAYWDP
    NCTC8325        KVTLLFTGPLTDLAKALQKDSSIVQYIEKLVWMGGTFLPKGNVEEPEHDGSAEWNAYWDP
    Newman          KVTLLFTGPLTDLAKALQKDSSIVQYIEKLVWMGGTFLPKGNVEEPEHDGSAEWNAYWDP
    USA300_FPR3757  KVTLLFTGPLTDLAKALQKDSSIVQYIEKLVWMGGTFLPKGNVEEPEHDGSAEWNAYWDP
                    ************************************************************

    COL             EAVKIVFDSDIEIDMVALESTNQVPLTLDVRQRWANERQYTGIDFLGVSYAAVPPLTHFI
    N315            EAVKIVFDSDIEIDMVALESTNQVPLTLDVRQRWANERQYTGIDFLGVSYAAVPPLTHFI
    NCTC8325        EAVKIVFDSDIEIDMVALESTNQVPLTLDVRQRWANERQYTGIDFLGVSYAAVPPLTHFI
    Newman          EAVKIVFDSDIEIDMVALESTNQVPLTLDVRQRWANERQYTGIDFLGVSYAAVPPLTHFI
    USA300_FPR3757  EAVKIVFDSDIEIDMVALESTNQVPLTLDVRQRWANERQYTGIDFLGVSYAAVPPLTHFI
                    ************************************************************

    COL             TNSTYFLWDVLTTAYIGNKDLVHSIEKKVDVISYGPSQGKTFECKDGRKINVINHVDNNA
    N315            TNSTYFLWDVLTTAYIGNKDLVHSIEKKVDVISYGPSQGKTFECKDGRKINVINHVDNNA
    NCTC8325        TNSTYFLWDVLTTAYIGNKDLVHSIEKKVDVISYGPSQGKTFECKDGRKINVINHVDNNA
    Newman          TNSTYFLWDVLTTAYIGNKDLVHSIEKKVDVISYGPSQGKTFECKDGRKINVINHVDNNA
    USA300_FPR3757  TNSTYFLWDVLTTAYIGNKDLVHSIEKKVDVISYGPSQGKTFECKDGRKINVINHVDNNA
                    ************************************************************

    COL             FFDYITALAKKVN
    N315            FFDYITALAKKVN
    NCTC8325        FFDYITALAKKVN
    Newman          FFDYITALAKKVN
    USA300_FPR3757  FFDYITALAKKVN
                    *************