From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005749000
  • symbol?: ydbM
  • description?: butyryl-CoA dehydrogenase

      descriptions from strain specific annotations:

    • butyryl-CoA dehydrogenase
    • acyl-CoA dehydrogenase-like protein
    • acyl-CoA dehydrogenase type 2
    • acyl-CoA dehydrogenase-related protein
    • Acyl-CoA dehydrogenase, short-chain specific
    • acyl-CoA dehydrogenase, middle domain-containing protein
    • Acyl-CoA dehydrogenase, type 2, C-terminal domain protein
    • acyl-CoA dehydrogenase, N-terminal domain protein
    • butyryl-CoA dehydrogenase-like protein
  • strand?: -
  • coordinates?: 5845677..5846623
  • synteny block?: BlockID0044950
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2223
    08BA02176:
    C248_2324
    11819-97:
    MS7_2304
    71193:
    ST398NM01_2336
    ECT-R 2:
    ECTR2_2146
    ED133:
    SAOV_2324c
    ED98:
    SAAV_2348
    HO 5096 0412:
    SAEMRSA15_21830
    JH1:
    SaurJH1_2352
    JH9:
    SaurJH9_2310
    JKD6008:
    SAA6008_02322 (caiA)
    JKD6159:
    SAA6159_02190 (caiA)
    LGA251:
    SARLGA251_20690
    M013:
    M013TW_2243
    MRSA252:
    SAR2369
    MSHR1132:
    SAMSHR1132_21110
    MSSA476:
    SAS2175
    Mu3:
    SAHV_2269
    Mu50:
    SAV2285
    MW2:
    MW2203
    RF122:
    SAB2157c
    ST398:
    SAPIG2336
    T0131:
    SAT0131_02463
    TCH60:
    HMPREF0772_10912
    TW20:
    SATW20_24170
    USA300_TCH1516:
    USA300HOU_2267
    VC40:
    SAVC_10290

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNDMDNSFLITTEIQRKWIEKFKVIRDTFKAKAEYNDQHSQFPYKNIEWLIKEGYGKLTL
    N315            MNDMDNSFLITTEIQRKWIEKFKVIRDTFKAKAEYNDQHSQFPYKNIEWLIKEGYGKLTL
    Newman          ------------------------------------------------------------
    USA300_FPR3757  MNDMDNSFLITTEIQRKWIEKFKVIRDTFKAKAEYNDQHSQFPYKNIEWLIKEGYGKLTL
                                                                                

    COL             PKAYGGEGATIEDMVILQSFLGELDGATALSIGWHVSVVGQIYEQKLWSQDMLEQFAVEI
    N315            PKAYGGEGATIEDMVILQSFLGELDGATALSIGWHVSVVGQIYEQKLWSQDMLEQFAVEI
    Newman          -------------MVILQSFLGELDGATALSIGWHVSVVGQIYEQKLWSQDMLEQFAVEI
    USA300_FPR3757  PKAYGGEGATIEDMVILQSFLGELDGATALSIGWHVSVVGQIYEQKLWSQDMLEQFAVEI
                                 ***********************************************

    COL             NNGALVNRAVSEAEMGSPTRGGRPSTHAVKADDGYILNGVKTYTSMSKALTHIIVAAYIE
    N315            NNGALVNRAVSEAEMGSPTRGGRPSTHAVKADDGYILNGVKTYTSMSKALTHIIVAAYIE
    Newman          NNGALVNRAVSEAEMGSPTRGGRPSTHAVKADDGYILNGVKTYTSMSKALTHIIVAAYIE
    USA300_FPR3757  NNGALVNRAVSEAEMGSPTRGGRPSTHAVKADDGYILNGVKTYTSMSKALTHIIVAAYIE
                    ************************************************************

    COL             ELESVGFFLVDRNLPGVEIADNWDVLGMRATESHDLILNDVKVPLKHLVETEKSKAPNGW
    N315            ELESVGFFLVDRNLPGVEIADNWDVLGMRATESHDLILNDVKVPLKHLVETEKSKAPNGW
    Newman          ELESVGFFLVDRNLPGVEIADNWDVLGMRATESHDLILNDVKVPLKHLVETEKSKAPNGW
    USA300_FPR3757  ELESVGFFLVDRNLPGVEIADNWDVLGMRATESHDLILNDVKVPLKHLVETEKSKAPNGW
                    ************************************************************

    COL             ILHIPSCYLGIAQAARNYAVDFAIQHSPNSIEGTIATLPTVQQNLGKMETLLLCARQFLW
    N315            ILHIPSCYLGIAQAARNYAVDFAIQHSPNSIEGTIATLPTVQQNLGKMETLLLCARQFLW
    Newman          ILHIPSCYLGIAQAARNYAVDFAIQHSPNSIEGTIATLPTVQQNLGKMETLLLCARQFLW
    USA300_FPR3757  ILHIPSCYLGIAQAARNYAVDFAIQHSPNSIEGTIATLPTVQQNLGKMETLLLCARQFLW
                    ************************************************************

    COL             STAKGYQQYKDDSQIRNPTSASKVMVMNQGLEVIDLAMRIVGAKSLEMNRPLQRYYRDMR
    N315            STAKGYQQYKDDSQIRNPTSASKVMVMNQGLEVIDLAMRIVGAKSLEMNRPLQRYYRDMR
    Newman          STAKGYQQYKDDSQIRNPTSASKVMVMNQGLEVIDLAMRIVGAKSLEMNRPLQRYYRDMR
    USA300_FPR3757  STAKGYQQYKDDSQIRNPTSASKVMVMNQGLEVIDLAMRIVGAKSLEMNRPLQRYYRDMR
                    ************************************************************

    COL             AGLHNPPMEDAAYTNIAKSITDTF
    N315            AGLHNPPMEDAAYTNIAKSITDTF
    Newman          AGLHNPPMEDAAYTNIAKSITDTF
    USA300_FPR3757  AGLHNPPMEDAAYTNIAKSITDTF
                    ************************