From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005753000
  • symbol?: ureA
  • description?: urease subunit gamma

      descriptions from strain specific annotations:

    • urease subunit gamma
    • urease, gamma subunit
    • Urease gamma subunit
    • urease subunit gamma (Urea amidohydrolase subunit gamma)
    • urease gamma subunit UreA
  • strand?: +
  • coordinates?: 5848458..5848805
  • synteny block?: BlockID0044990
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2280 (ureA)
    N315:
    SA2082 (ureA)
    NCTC8325:
    Newman:
    NWMN_2188 (ureA)
    USA300_FPR3757:
    04-02981:
    SA2981_2226 (ureA)
    08BA02176:
    C248_2327 (ureA)
    11819-97:
    MS7_2306 (ureA)
    71193:
    ST398NM01_2338
    ECT-R 2:
    ECTR2_2148 (ureA)
    ED133:
    SAOV_2327
    ED98:
    SAAV_2350 (ureA)
    HO 5096 0412:
    SAEMRSA15_21850 (ureA)
    JH1:
    SaurJH1_2355 (ureA)
    JH9:
    SaurJH9_2312 (ureA)
    JKD6008:
    SAA6008_02324 (ureA)
    JKD6159:
    SAA6159_02192 (ureA)
    LGA251:
    SARLGA251_20710 (ureA)
    M013:
    M013TW_2245
    MRSA252:
    SAR2372 (ureA)
    MSHR1132:
    SAMSHR1132_21130
    MSSA476:
    SAS2178 (ureA)
    Mu3:
    SAHV_2272 (ureA)
    Mu50:
    SAV2288 (ureA)
    MW2:
    MW2206 (ureA)
    RF122:
    SAB2160 (ureA)
    ST398:
    SAPIG2338 (ureA)
    T0131:
    SAT0131_02465
    TCH60:
    HMPREF0772_10910 (ureA)
    TW20:
    SATW20_24190 (ureA)
    USA300_TCH1516:
    USA300HOU_2269 (ureA)
    VC40:
    SAVC_10300 (ureA)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MHFTQREQDKLMIVVAAEVARRRKARGLKLNHPEALALISDELLEGARDGKTVAELMSYG
    N315            MHFTQREQDKLMIVVAAEVARRRKARGLKLNHPEALALISDELLEGARDGKTVAELMSYG
    NCTC8325        MHFTQREQDKLMIVVAAEVARRRKARGLKLNHPEALALISDELLEGARDGKTVAELMSYG
    Newman          MHFTQREQDKLMIVVAAEVARRRKARGLKLNHPEALALISDELLEGARDGKTVAELMSYG
    USA300_FPR3757  MHFTQREQDKLMIVVAAEVARRRKARGLKLNHPEALALISDELLEGARDGKTVAELMSYG
                    ************************************************************

    COL             RQILNKEDVMDGVEHMITDIEIEATFPDGTKLITVHHPIV
    N315            RQILNKEDVMDGVEHMITDIEIEATFPDGTKLITVHHPIV
    NCTC8325        RQILNKEDVMDGVEHMITDIEIEATFPDGTKLITVHHPIV
    Newman          RQILNKEDVMDGVEHMITDIEIEATFPDGTKLITVHHPIV
    USA300_FPR3757  RQILNKEDVMDGVEHMITDIEIEATFPDGTKLITVHHPIV
                    ****************************************