From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005754000
  • symbol?: ureB
  • description?: urease subunit beta

      descriptions from strain specific annotations:

    • urease subunit beta
    • urease, beta subunit
    • Urease beta subunit
    • urease subunit beta (Urea amidohydrolase subunit beta)
    • urease subunit beta UreB
  • strand?: +
  • coordinates?: 5848798..5849280
  • synteny block?: BlockID0045000
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2281 (ureB)
    N315:
    SA2083 (ureB)
    NCTC8325:
    Newman:
    NWMN_2189 (ureB)
    USA300_FPR3757:
    04-02981:
    SA2981_2227 (ureB)
    08BA02176:
    C248_2328 (ureB)
    11819-97:
    MS7_2307 (ureB)
    71193:
    ST398NM01_2339
    ECT-R 2:
    ECTR2_2149 (ureB)
    ED133:
    SAOV_2328
    ED98:
    SAAV_2351 (ureB)
    HO 5096 0412:
    SAEMRSA15_21860 (ureB)
    JH1:
    SaurJH1_2356 (ureB)
    JH9:
    SaurJH9_2313 (ureB)
    JKD6008:
    SAA6008_02325 (ureB)
    JKD6159:
    SAA6159_02193 (ureB)
    LGA251:
    SARLGA251_20720 (ureB)
    M013:
    M013TW_2246
    MRSA252:
    SAR2373 (ureB)
    MSHR1132:
    SAMSHR1132_21140
    MSSA476:
    SAS2179 (ureB)
    Mu3:
    SAHV_2273 (ureB)
    Mu50:
    SAV2289 (ureB)
    MW2:
    MW2207 (ureB)
    RF122:
    SAB2161 (ureB)
    ST398:
    SAPIG2339 (ureB)
    T0131:
    SAT0131_02466 (panD)
    TCH60:
    HMPREF0772_10909 (ureB)
    TW20:
    SATW20_24200 (ureB)
    USA300_TCH1516:
    USA300HOU_2270 (ureB)
    VC40:
    SAVC_10305 (ureB)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIPGEIITKSTEVEINNHHPETVIEVENTGDRPIQVGSHFHFYEANAALDFEREMAYGKH
    N315            MIPGEIITKSTEVEINNHHPETVIEVENTGDRPIQVGSHFHFYEANAALDFEREMAYGKH
    NCTC8325        MIPGEIITKSTEVEINNHHPETVIEVENTGDRPIQVGSHFHFYEANAALDFEREMAYGKH
    Newman          MIPGEIITKSTEVEINNHHPETVIEVENTGDRPIQVGSHFHFYEANAALDFEREMAYGKH
    USA300_FPR3757  MIPGEIITKSTEVEINNHHPETVIEVENTGDRPIQVGSHFHFYEANAALDFEREMAYGKH
                    ************************************************************

    COL             LDIPAGAAVRFEPGDKKEVQLVEYAGKRKIFGFRGMVNGPIDESRVYRPTDENDEYAGVF
    N315            LDIPAGAAVRFEPGDKKEVQLVEYAGKRKIFGFRGMVNGPIDESRVYRPTDENDAYAGVF
    NCTC8325        LDIPAGAAVRFEPGDKKEVQLVEYAGKRKIFGFRGMVNGPIDESRVYRPTDENDEYAGVF
    Newman          LDIPAGAAVRFEPGDKKEVQLVEYAGKRKIFGFRGMVNGPIDESRVYRPTDENDEYAGVF
    USA300_FPR3757  LDIPAGAAVRFEPGDKKEVQLVEYAGKRKIFGFRGMVNGPIDESRVYRPTDENDEYAGVF
                    ****************************************************** *****

    COL             GDNGAENVNKKGGKRS
    N315            GDNGAENVNKKGGKRS
    NCTC8325        GDNGAENVNKKGGKRS
    Newman          GDNGAENVNKKGRKRS
    USA300_FPR3757  GDNGAENVNKKGGKRS
                    ************ ***