From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005755000
  • symbol?: ureC
  • description?: urease subunit alpha

      descriptions from strain specific annotations:

    • urease subunit alpha
    • Urease alpha subunit
    • urease, alpha subunit
    • urease alpha subunit (pseudogene)
    • urease alpha subunit UreC
  • strand?: +
  • coordinates?: 5849277..5850992
  • synteny block?: BlockID0045010
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2282 (ureC)
    N315:
    SA2084 (ureC)
    NCTC8325:
    Newman:
    NWMN_2190 (ureC)
    USA300_FPR3757:
    04-02981:
    SA2981_2228 (ureC)
    08BA02176:
    C248_2329 (ureC)
    11819-97:
    MS7_2308 (ureC)
    71193:
    ST398NM01_2340
    ECT-R 2:
    ECTR2_2150 (ureC)
    ED133:
    SAOV_2329
    ED98:
    SAAV_2352 (ureC)
    HO 5096 0412:
    SAEMRSA15_21870 (ureC)
    JH1:
    SaurJH1_2357 (ureC)
    JH9:
    SaurJH9_2314 (ureC)
    JKD6008:
    SAA6008_02326 (ureC)
    JKD6159:
    SAA6159_02194 (ureC)
    LGA251:
    SARLGA251_20730 (ureC)
    M013:
    M013TW_2247
    MRSA252:
    SAR2374 (ureC)
    MSHR1132:
    SAMSHR1132_21150
    MSSA476:
    SAS2180 (ureC)
    Mu3:
    SAHV_2274 (ureC)
    Mu50:
    SAV2290 (ureC)
    MW2:
    MW2208 (ureC)
    RF122:
    SAB2162 (ureC)
    ST398:
    SAPIG2340 (ureC)
    T0131:
    SAT0131_02468 (panC)
    TCH60:
    HMPREF0772_10908 (ureC)
    TW20:
    SATW20_24210 (ureC)
    USA300_TCH1516:
    USA300HOU_2271 (ureC)
    VC40:
    SAVC_10310 (ureC)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSFKMTQNQYTSLYGPTVGDSIRLGDTNLFAQIEKDYAVYGEEATFGGGKSIRDGMAQNP
    N315            MSFKMTQNQYTSLYGPTVGDSIRLGDTNLFAQIEKDYAVYGEEATFGGGKSIRDGMAQNP
    NCTC8325        MSFKMTQNQYTSLYGPTVGDSIRLGDTNLFAQIEKDYAVYGEEATFGGGKSIRDGMAQNP
    Newman          MSFKMTQNQYTSLYGPTVGDSIRLGDTNLFAQIEKDYAVYGEEATFGGGKSIRDGMAQNP
    USA300_FPR3757  MSFKMTQNQYTSLYGPTVGDSIRLGDTNLFAQIEKDYAVYGEEATFGGGKSIRDGMAQNP
                    ************************************************************

    COL             RVTRDDVNVADLVISNAVIIDYDKVVKADIGIKNGYIFAIGNAGNPDIMDNVDIIIGSTT
    N315            RVTRDDVNVADLVISNAVIIDYDKVVKADIGIKNGYIFAIGNAGNPDIMDNVDIIIGSTT
    NCTC8325        RVTRDDVNVADLVISNAVIIDYDKVVKADIGIKNGYIFAIGNAGNPDIMDNVDIIIGSTT
    Newman          RVTRDDVNVADLVISNAVIIDYDKVVKADIGIKNGYIFAIGNAGNPDIMDNVDIIIGSTT
    USA300_FPR3757  RVTRDDVNVADLVISNAVIIDYDKVVKADIGIKNGYIFAIGNAGNPDIMDNVDIIIGSTT
                    ************************************************************

    COL             DIIAAEGKIVTAGGIDTHVHFINPEQAEVALESGITTHIGGGTGASEGSKATTVTPGPWH
    N315            DIIAAEGKIVTAGGIDTHVHFINPEQAEVALESGITTHIGGGTGASEGSKATTVTPGPWH
    NCTC8325        DIIAAEGKIVTAGGIDTHVHFINPEQAEVALESGITTHIGGGTGASEGSKATTVTPGPWH
    Newman          DIIAAEGKIVTAGGIDTHVHFINPEQAEVALESGITTHIGGGTGASEGSKATTVTPGPWH
    USA300_FPR3757  DIIAAEGKIVTAGGIDTHVHFINPEQAEVALESGITTHIGGGTGASEGSKATTVTPGPWH
                    ************************************************************

    COL             IHRMLEAAEGLPINVGFTGKGQATNPTALIEQINAGAIGLKVHEDWGATPSALSHALDVA
    N315            IHRMLEAAEGLPINVGFTGKGQATNPTALIEQINAGAIGLKVHEDWGATPSALSHALDVA
    NCTC8325        IHRMLEAAEGLPINVGFTGKGQATNPTALIEQINAGAIGLKVHEDWGATPSALSHALDVA
    Newman          IHRMLEAAEGLPINVGFTGKGQATNPTALIEQINAGAIGLKVHEDWGATPSALSHALDVA
    USA300_FPR3757  IHRMLEAAEGLPINVGFTGKGQATNPTALIEQINAGAIGLKVHEDWGATPSALSHALDVA
                    ************************************************************

    COL             DEFDVQIALHADTLNEAGFMEDTMAAVKDRVLHMYHTEGAGGGHAPDLIKSAAFSNILPS
    N315            DEFDVQIALHADTLNEAGFMEDTMAAVKDRVLHMYHTEGAGGGHAPDLIKSAAFSNILPS
    NCTC8325        DEFDVQIALHADTLNEAGFMEDTMAAVKDRVLHMYHTEGAGGGHAPDLIKSAAFSNILPS
    Newman          DEFDVQIALHADTLNEAGFMEDTMAAVKDRVLHMYHTEGAGGGHAPDLIKSAAFSNILPS
    USA300_FPR3757  DEFDVQIALHADTLNEAGFMEDTMAAVKDRVLHMYHTEGAGGGHAPDLIKSAAFSNILPS
                    ************************************************************

    COL             STNPTLPYTHNTVDEHLDMVMITHHLNAAIPEDIAFADSRIRKETIAAEDVLQDMGVFSM
    N315            STNPTLPYTHNTVDEHLDMVMITHHLNAAIPEDIAFADSRIRKETIAAEDVLQDMGVFSM
    NCTC8325        STNPTLPYTHNTVDEHLDMVMITHHLNAAIPEDIAFADSRIRKETIAAEDVLQDMGVFSM
    Newman          STNPTLPYTHNTVDEHLDMVMITHHLNAAIPEDIAFADSRIRKETIAAEDVLQDMGVFSM
    USA300_FPR3757  STNPTLPYTHNTVDEHLDMVMITHHLNAAIPEDIAFADSRIRKETIAAEDVLQDMGVFSM
                    ************************************************************

    COL             ISSDSQAMGRVGEVITRTWQVAHRMKEQRGPLDGDFEHNDNNRIKRYIAKYTINPAITHG
    N315            ISSDSQAMGRVGEVITRTWQVAHRMKEQRGPLDGDFEHNDNNRIKRYIAKYTINPAITHG
    NCTC8325        ISSDSQAMGRVGEVITRTWQVAHRMKEQRGPLDGDFEHNDNNRIKRYIAKYTINPAITHG
    Newman          ISSDSQAMGRVGEVITRTWQVAHRMKEQRGPLDGDFEHNDNNRIKRYIAKYTINPAITHG
    USA300_FPR3757  ISSDSQAMGRVGEVITRTWQVAHRMKEQRGPLDGDFEHNDNNRIKRYIAKYTINPAITHG
                    ************************************************************

    COL             ISEYVGSIEPGKLADIVLWDPIFFGVKPELVVKGGLINSAVNGDANGSIPTSEPMKYRKM
    N315            ISEYVGSIEPGKLADIVLWDPIFFGVKPELVVKGGLINSAVNGDANGSIPTSEPMKYRKM
    NCTC8325        ISEYVGSIEPGKLADIVLWDPIFFGVKPELVVKGGLINSAVNGDANGSIPTSEPMKYRKM
    Newman          ISEYVGSIEPGKLADIVLWDPIFFGVKPELVVKGGLINSAVNGDANGSIPTSEPMKYRKM
    USA300_FPR3757  ISEYVGSIEPGKLADIVLWDPIFFGVKPELVVKGGLINSAVNGDANGSIPTSEPMKYRKM
                    ************************************************************

    COL             YGQYGGNLTSTSMTFVSKTAYENGINRALNLKRMVRPVKNIRQLSKADMKNNSATPKLDV
    N315            YGQYGGNLTSTSMTFVSKTAYENGINRALNLKRMVRPVKNIRQLSKADMKNNSATPKLDV
    NCTC8325        YGQYGGNLTSTSMTFVSKTAYENGINRALNLKRMVRPVKNIRQLSKADMKNNSATPKLDV
    Newman          YGQYGGNLTSTSMTFVSKTAYENGINRALNLKRMVRPVKNIRQLSKADMKNNSATPKLDV
    USA300_FPR3757  YGQYGGNLTSTSMTFVSKTAYENGINRALNLKRMVRPVKNIRQLSKADMKNNSATPKLDV
                    ************************************************************

    COL             DPQTYEVYVDGEKITSNAATELPLTQRYFLF
    N315            DPQTYEVYVDGEKITSNAATELPLTQRYFLF
    NCTC8325        DPQTYEVYVDGEKITSNAATELPLTQRYFLF
    Newman          DPQTYEVYVDGEKITSNAATELPLTQRYFLF
    USA300_FPR3757  DPQTYEVYVDGEKITSNAATELPLTQRYFLF
                    *******************************