From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005758000
  • symbol?: ureG
  • description?: urease accessory protein UreG
  • strand?: +
  • coordinates?: 5852152..5852766
  • synteny block?: BlockID0045040
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2285 (ureG)
    N315:
    SA2087 (ureG)
    NCTC8325:
    Newman:
    NWMN_2193 (ureG)
    USA300_FPR3757:
    04-02981:
    SA2981_2231 (ureG)
    08BA02176:
    C248_2332 (ureG)
    11819-97:
    MS7_2311 (ureG)
    71193:
    ST398NM01_2343
    ECT-R 2:
    ECTR2_2153 (ureG)
    ED133:
    SAOV_2332
    ED98:
    SAAV_2355 (ureG)
    HO 5096 0412:
    SAEMRSA15_21900 (ureG)
    JH1:
    SaurJH1_2360
    JH9:
    SaurJH9_2317
    JKD6008:
    SAA6008_02329 (ureG)
    JKD6159:
    SAA6159_02197 (ureG)
    LGA251:
    SARLGA251_20760 (ureG)
    M013:
    M013TW_2250
    MRSA252:
    SAR2377 (ureG)
    MSHR1132:
    SAMSHR1132_21180
    MSSA476:
    SAS2183
    Mu3:
    SAHV_2277 (ureG)
    Mu50:
    SAV2293 (ureG)
    MW2:
    MW2211 (ureG)
    RF122:
    SAB2165 (ureG)
    ST398:
    SAPIG2343 (ureG)
    T0131:
    SAT0131_02471 (budA2)
    TCH60:
    HMPREF0772_10905 (ureG)
    TW20:
    SATW20_24240 (ureG)
    USA300_TCH1516:
    USA300HOU_2274 (ureG)
    VC40:
    SAVC_10325

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MANPIKIGIGGPVGAGKTQLIEKVVKRLSKEMSIGVITNDIYTKEDEKILVNSGVLPESR
    N315            MANPIKIGIGGPVGAGKTQLIEKVVKRLSKEMSIGVITNDIYTKEDEKILVNSGVLPESR
    NCTC8325        MANPIKIGIGGPVGAGKTQLIEKVVKRLSKEMSIGVITNDIYTKEDEKILVNSGVLPESR
    Newman          MANPIKIGIGGPVGAGKTQLIEKVVKRLSKEMSIGVITNDIYTKEDEKILVNSGVLPESR
    USA300_FPR3757  MANPIKIGIGGPVGAGKTQLIEKVVKRLSKEMSIGVITNDIYTKEDEKILVNSGVLPESR
                    ************************************************************

    COL             IIGVETGGCPHTAIREDASMNFAAIDELLERHDDIELIFIESGGDNLAATFSPELVDFSI
    N315            IIGVETGGCPHTAIREDASMNFAAIDELLERHDDIELIFIESGGDNLAATFSPELVDFSI
    NCTC8325        IIGVETGGCPHTAIREDASMNFAAIDELLERHDDIELIFIESGGDNLAATFSPELVDFSI
    Newman          IIGVETGGCPHTAIREDASMNFAAIDELLERHDDIELIFIESGGDNLAATFSPELVDFSI
    USA300_FPR3757  IIGVETGGCPHTAIREDASMNFAAIDELLERHDDIELIFIESGGDNLAATFSPELVDFSI
                    ************************************************************

    COL             YIIDVAQGEKIPRKGGQGMIKSDFFVINKTDLAPYVGASLEQMAEDTKVFRGKRPFTFTN
    N315            YIIDVAQGEKIPRKGGQGMIKSDFFVINKTDLAPYVGASLEQMAEDTKVFRGKRPFTFTN
    NCTC8325        YIIDVAQGEKIPRKGGQGMIKSDFFVINKTDLAPYVGASLEQMAEDTKVFRGKRPFTFTN
    Newman          YIIDVAQGEKIPRKGGQGMIKSDFFVINKTDLAPYVGASLEQMAEDTKVFRGKRPFTFTN
    USA300_FPR3757  YIIDVAQGEKIPRKGGQGMIKSDFFVINKTDLAPYVGASLEQMAEDTKVFRGKRPFTFTN
                    ************************************************************

    COL             LKTDEGLDEVIDWIERDTLLKGLS
    N315            LKTDEGLDEVIDWIERDTLLKGLS
    NCTC8325        LKTDEGLDEVIDWIERDTLLKGLS
    Newman          LKTDEGLDEVIDWIERDTLLKGLS
    USA300_FPR3757  LKTDEGLDEVIDWIERDTLLKGLS
                    ************************