From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005760000
  • symbol?: sarR
  • description?: accessory regulator A-like protein

      descriptions from strain specific annotations:

    • accessory regulator A-like protein
    • accessory regulator R
    • SarA family transcriptional regulator
    • transcriptional regulator SarR
    • HTH-type transcriptional regulator SarR
    • HTH-type transcriptional regulator SarR (Staphylococcal accessoryregulator R)
    • staphylococcal accessory regulator protein
    • staphylococcal accessory regulator R, SarR
    • Staphylococcal accessory regulator R
    • Accessory regulator protein
  • strand?: -
  • coordinates?: 5853793..5854140
  • synteny block?: BlockID0045060
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2287 (sarR)
    N315:
    SA2089 (sarR)
    NCTC8325:
    Newman:
    NWMN_2195 (sarR)
    USA300_FPR3757:
    04-02981:
    SA2981_2233 (sarR)
    08BA02176:
    C248_2334 (sarR)
    11819-97:
    MS7_2313 (sarR)
    71193:
    ST398NM01_2345
    ECT-R 2:
    ECTR2_2155
    ED133:
    SAOV_2334c
    ED98:
    SAAV_2357 (sarR)
    HO 5096 0412:
    SAEMRSA15_21920 (sarR)
    JH1:
    SaurJH1_2362
    JH9:
    SaurJH9_2319
    JKD6008:
    SAA6008_02331 (sarR)
    JKD6159:
    SAA6159_02199 (sarR)
    LGA251:
    SARLGA251_20780 (sarR)
    M013:
    M013TW_2252
    MRSA252:
    SAR2379 (sarR)
    MSHR1132:
    SAMSHR1132_21200
    MSSA476:
    SAS2185
    Mu3:
    SAHV_2279 (sarR)
    Mu50:
    SAV2295 (sarR)
    MW2:
    MW2213 (sarR)
    RF122:
    SAB2167c (sarR)
    ST398:
    SAPIG2345
    T0131:
    SAT0131_02473
    TCH60:
    HMPREF0772_10903 (sarR)
    TW20:
    SATW20_24260 (sarR)
    USA300_TCH1516:
    USA300HOU_2276 (sarR)
    VC40:
    SAVC_10335

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSKINDINDLVNATFQVKKFFRDTKKKFNLNYEEIYILNHILRSESNEISSKEIAKCSEF
    N315            MSKINDINDLVNATFQVKKFFRDTKKKFNLNYEEIYILNHILRSESNEISSKEIAKCSEF
    NCTC8325        MSKINDINDLVNATFQVKKFFRDTKKKFNLNYEEIYILNHILRSESNEISSKEIAKCSEF
    Newman          MSKINDINDLVNATFQVKKFFRDTKKKFNLNYEEIYILNHILRSESNEISSKEIAKCSEF
    USA300_FPR3757  MSKINDINDLVNATFQVKKFFRDTKKKFNLNYEEIYILNHILRSESNEISSKEIAKCSEF
                    ************************************************************

    COL             KPYYLTKALQKLKDLKLLSKKRSLQDERTVIVYVTDTQKANIQKLISELEEYIKN
    N315            KPYYLTKALQKLKDLKLLSKKRSLQDERTVIVYVTDTQKANIQKLISELEEYIKN
    NCTC8325        KPYYLTKALQKLKDLKLLSKKRSLQDERTVIVYVTDTQKANIQKLISELEEYIKN
    Newman          KPYYLTKALQKLKDLKLLSKKRSLQDERTVIVYVTDTQKANIQKLISELEEYIKN
    USA300_FPR3757  KPYYLTKALQKLKDLKLLSKKRSLQDERTVIVYVTDTQKANIQKLISELEEYIKN
                    *******************************************************