From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005763000
  • symbol?: sarY
  • description?: accessory regulator A-like protein

      descriptions from strain specific annotations:

    • accessory regulator A-like protein
    • staphylococcal accessory regulator family
    • SarA family transcriptional regulator
    • staphylococcal accessory regulator Y
  • strand?: -
  • coordinates?: 5854961..5855704
  • synteny block?: BlockID0045090
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2289 (sarY)
    N315:
    NCTC8325:
    Newman:
    NWMN_2197 (sarY)
    USA300_FPR3757:
    04-02981:
    SA2981_2235
    08BA02176:
    C248_2336
    11819-97:
    MS7_2315 (sarY)
    71193:
    ST398NM01_2347
    ECT-R 2:
    ECTR2_2157
    ED133:
    SAOV_2336c
    ED98:
    SAAV_2359 (sarY)
    HO 5096 0412:
    SAEMRSA15_21940
    JH1:
    SaurJH1_2364
    JH9:
    SaurJH9_2321
    JKD6008:
    SAA6008_02333 (sarY)
    JKD6159:
    SAA6159_02201
    LGA251:
    SARLGA251_20800
    M013:
    M013TW_2254
    MRSA252:
    SAR2381
    MSHR1132:
    SAMSHR1132_21220
    MSSA476:
    SAS2187
    Mu3:
    SAHV_2281
    Mu50:
    SAV2297
    MW2:
    MW2215
    RF122:
    SAB2169c
    ST398:
    SAPIG2347
    T0131:
    SAT0131_02476 (pheT)
    TCH60:
    HMPREF0772_10901 (sarY)
    TW20:
    SATW20_24280
    USA300_TCH1516:
    USA300HOU_2278 (sarY)
    VC40:
    SAVC_10345

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSKFKVKRLTAHILMLKVINDMLKYSFHLTLTQVKLLNLLVKYDNSDSNSASIDSLLKMK
    N315            MSKFKVKRLTAHILMLKVINDMLKYSFHLTLTQVKLLNLLVKYDNSDSNSASIDRLLKMK
    NCTC8325        MSKFKVKRLTAHILMLKVINDMLKYSFHLTLTQVKLLNLLVKYDNSDSNSASIDSLLKMK
    Newman          MSKFKVKRLTAHILMLKVINDMLKYSFHLTLTQVKLLNLLVKYDNSDSNSASIDSLLKMK
    USA300_FPR3757  MSKFKVKRLTAHILMLKVINDMLKYSFHLTLTQVKLLNLLVKYDNSDSNSASIDSLLKMK
                    ****************************************************** *****

    COL             EIQSKMALLQMLSYLNNHQWLLKGRDQRDQRKLTISINKMHIDKIEYMNNELSDYIERYF
    N315            EIQSKMALLQMLSYLNNHQWLLKGRDQRDQRKLTISINKMHIDKIEYMNNELSDYIERYF
    NCTC8325        EIQSKMALLQMLSYLNNHQWLLKGRDQRDQRKLTISINKMHIDKIEYMNNELSDYIERYF
    Newman          EIQSKMALLQMLSYLNNHQWLLKGRDQRDQRKLTISINKMHIDKIEYMNNELSDYIERYF
    USA300_FPR3757  EIQSKMALLQMLSYLNNHQWLLKGRDQRDQRKLTISINKMHIDKIEYMNNELSDYIERYF
                    ************************************************************

    COL             GQYTFDFSCDYVSYLLSSQELLRNLKCYLNMCQLSLEELYVLGILNLHKGQLTVKELQGE
    N315            GQYTFDFSCDYVSYLLSSQELFRNLKCYLNMCQLTLEELYVLGILNLHKGQLTVKELQGE
    NCTC8325        GQYTFDFSCDYVSYLLSSQELLRNLKCYLNMCQLSLEELYVLGILNLHKGQLTVKELQGE
    Newman          GQYTFDFSCDYVSYLLSSQELLRNLKCYLNMCQLSLEELYVLGILNLHKGQLTVKELQGE
    USA300_FPR3757  GQYTFDFSCDYVSYLLSSQELLRNLKCYLNMCQLSLEELYVLGILNLHKGQLTVKELQGE
                    *********************:************:*************************

    COL             FHHPIFAVSPILKCLILKGLVKKERCELDERRVIVTIKREKFSKVTMLIQACYNYLEKGI
    N315            FHHPIFAVSPILKCLILKGLVKKERCELDERRVIVTIKREKFSKVTMLIQACYNYLEKGI
    NCTC8325        FHHPIFAVSPILKCLILKGLVKKERCELDERRVIVTIKREKFSKVTMLIQACYNYLEKGI
    Newman          FHHPIFAVSPILKCLILKGLVKKERCELDERRVIVTIKREKFSKVTMLIQACYNYLEKGI
    USA300_FPR3757  FHHPIFAVSPILKCLILKGLVKKERCELDERRVIVTIKREKFSKVTMLIQACYNYLEKGI
                    ************************************************************

    COL             QVNLNNK
    N315            QVKLNNK
    NCTC8325        QVKLNNK
    Newman          QVNLNNK
    USA300_FPR3757  QVNLNNK
                    **:****