From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005775000
  • symbol?:
  • description?: 2-hydroxyacid dehydrogenase

      descriptions from strain specific annotations:

    • 2-hydroxyacid dehydrogenase
    • glycerate dehydrogenase
    • D-isomer specific 2-hydroxyacid dehydrogenase NAD binding domain-containing protein
    • D-isomer specific 2-hydroxyacid dehydrogenase family protein
    • glycerate dehydrogenase-like protein
    • Glyoxylate reductase / Glyoxylate reductase / Hydroxypyruvate reductase
    • putative D-isomer specific 2-hydroxyaciddehydrogenase
    • (R)-2-hydroxyacid dehydrogenase
    • D-isomer specific 2-hydroxyacid dehydrogenase
    • D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding subunit
    • glyoxylate reductase (Glycolate reductase)
    • glyoxylate reductase (NAD+)
    • Putative 2-hydroxyacid dehydrogenase
  • strand?: +
  • coordinates?: 5864026..5864979
  • synteny block?: BlockID0045210
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2243
    08BA02176:
    C248_2345
    11819-97:
    MS7_2322
    71193:
    ST398NM01_2355
    ECT-R 2:
    ECTR2_2164
    ED133:
    SAOV_2344
    ED98:
    SAAV_2366
    HO 5096 0412:
    SAEMRSA15_22020
    JH1:
    SaurJH1_2371
    JH9:
    SaurJH9_2328
    JKD6008:
    SAA6008_02340
    JKD6159:
    SAA6159_02208
    LGA251:
    SARLGA251_20870
    M013:
    M013TW_2261
    MRSA252:
    SAR2389
    MSHR1132:
    SAMSHR1132_21290
    MSSA476:
    SAS2196
    Mu3:
    SAHV_2289
    Mu50:
    SAV2305
    MW2:
    MW2224
    RF122:
    SAB2178
    ST398:
    SAPIG2355
    T0131:
    SAT0131_02483 (fda)
    TCH60:
    HMPREF0772_10892 (gyaR)
    TW20:
    SATW20_24350
    USA300_TCH1516:
    USA300HOU_2286
    VC40:
    SAVC_10380

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEKVYVAGAIPEVGLKLLQEHFEVEMYEGKGLVDKDTLIKGVKNATALISLLSTNVDKDV
    N315            MEKVYVAGAIPEVGLKLLQEHFEVEMYEGKGLVDKDTLIKGVKNATALISLLSTNVDKDV
    NCTC8325        MEKVYVAGAIPEVGLKLLQEHFEVEMYEGKGLVDKDTLIKGVKNATALISLLSTNVDKDV
    Newman          MEKVYVAGAIPEVGLKLLQEHFEVEMYEGKGLVDKDTLIKGVKNATALISLLSTNVDKDV
    USA300_FPR3757  MEKVYVAGAIPEVGLKLLQEHFEVEMYEGKGLVDKDTLIKGVKNATALISLLSTNVDKDV
                    ************************************************************

    COL             IDAGKDLKIIANYGAGFNNIDIEYAREKSIDVTNTPKASTNATADLTIGLVLAVARRIVE
    N315            IDAGKDLKIIANYGAGFNNIDIEYAREKSIDVTNTPKASTNATADLTIGLVLAVARRIVE
    NCTC8325        IDAGKDLKIIANYGAGFNNIDIEYAREKSIDVTNTPKASTNATADLTIGLVLAVARRIVE
    Newman          IDAGKDLKIIANYGAGFNNIDIEYAREKSIDVTNTPKASTNATADLTIGLVLAVARRIVE
    USA300_FPR3757  IDAGKDLKIIANYGAGFNNIDIEYAREKSIDVTNTPKASTNATADLTIGLVLAVARRIVE
                    ************************************************************

    COL             GDQLSRTTGFDGWAPLFFRGREVSGKTIGIIGLGEIGSAVARRARAFDMDVLYTGPNRKE
    N315            GDQLSRTTGFDGWAPLFFRGREVSGKTIGIIGLGEIGSAVARRARAFDMDVLYTGPNRKE
    NCTC8325        GDQLSRTTGFDGWAPLFFRGREVSGKTIGIIGLGEIGSAVARRARAFDMDVLYTGPNRKE
    Newman          GDQLSRTTGFDGWAPLFFRGREVSGKTIGIIGLGEIGSAVARRARAFDMDVLYTGPNRKE
    USA300_FPR3757  GDQLSRTTGFDGWAPLFFRGREVSGKTIGIIGLGEIGSAVARRARAFDMDVLYTGPNRKE
                    ************************************************************

    COL             EKEREIGAKYVDLDTLLKNADFITINAAYNPKMHHLIDTEQFKMMKSTAYLINASRGPIV
    N315            EKEREIGAKYVDLDTLLKNADFITINAAYNPKMHHLIDTEQFKMMKSTVYLINASRGPIV
    NCTC8325        EKEREIGAKYVDLDTLLKNADFITINAAYNPKMHHLIDTEQFKMMKSTAYLINASRGPIV
    Newman          EKEREIGAKYVDLDTLLKNADFITINAAYNPKMHHLIDTEQFKMMKSTAYLINASRGPIV
    USA300_FPR3757  EKEREIGAKYVDLDTLLKNADFITINAAYNPKMHHLIDTEQFKMMKSTAYLINASRGPIV
                    ************************************************.***********

    COL             HEQALVQALKDNEIEGAALDVYEFEPDITDDLKSLNNVVLTPHIGNATFEARDMMSKIVA
    N315            HEQALVQALKDNEIEGAALDVYEFEPDITDDLKSLNNVVLTPHIGNATFEARDMMSKIVA
    NCTC8325        HEQALVQALKDNEIEGAALDVYEFEPDITDDLKSLNNVVLTPHIGNATFEARDMMSKIVA
    Newman          HEQALVQALKDNEIEGAALDVYEFEPDITDDLKSLNNVVLTPHIGNATFEARDMMSKIVA
    USA300_FPR3757  HEQALVQALKDNEIEGAALDVYEFEPDITDDLKSLNNVVLTPHIGNATFEARDMMSKIVA
                    ************************************************************

    COL             NAAISAVQGEKPQFVVN
    N315            NAAISAVQGEKPQFVVN
    NCTC8325        NAAISAVQGEKPQFVVN
    Newman          NAAISAVQGEKPQFVVN
    USA300_FPR3757  NAAISAVQGEKPQFVVN
                    *****************