From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005788000
  • symbol?:
  • description?: transcriptional regulator

      descriptions from strain specific annotations:

    • transcriptional regulator
    • cell envelope-related transcriptional attenuator
    • putative transcriptional regulator
    • membrane-bound protein lytR
    • transcriptional regulator, putative
    • cell envelope-associated transcriptional attenuator
    • Cell envelope-associated transcriptional attenuator LytR-CpsA-Psr, subfamily F2
    • cell envelope transcriptional attenuator
    • LytR family transcriptional regulator
    • transcriptional regulator lytR
    • transcription antiterminator LytR
  • strand?: -
  • coordinates?: 5875795..5876649
  • synteny block?: BlockID0045330
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2249
    08BA02176:
    C248_2352
    11819-97:
    MS7_2327
    71193:
    ST398NM01_2361
    ECT-R 2:
    ECTR2_2169
    ED133:
    SAOV_2350c
    ED98:
    SAAV_2372
    HO 5096 0412:
    SAEMRSA15_22080
    JH1:
    SaurJH1_2377
    JH9:
    SaurJH9_2334
    JKD6008:
    SAA6008_02345
    JKD6159:
    SAA6159_02214
    LGA251:
    SARLGA251_20930
    M013:
    M013TW_2267
    MRSA252:
    SAR2394
    MSHR1132:
    SAMSHR1132_21350
    MSSA476:
    SAS2202
    Mu3:
    SAHV_2294
    Mu50:
    SAV2310
    MW2:
    MW2230
    RF122:
    SAB2187c
    ST398:
    SAPIG2361
    T0131:
    SAT0131_02490 (sdhA)
    TCH60:
    HMPREF0772_10885 (lytR2)
    TW20:
    SATW20_24410
    USA300_TCH1516:
    USA300HOU_2292
    VC40:
    SAVC_10410

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGLKRSSKSKMSLPKKIFLWVFGILVILAIVAVVYVAAKIFITGNKIHNPLDRNHSELRD
    N315            --MKRSSKSKMSLPKKIFLWVFGILVILAIVAVVYVAAKIFITGNKIHNPLDRNHSELRD
    NCTC8325        ----------MSLPKKIFLWVFGILVILAIVAVVYVAAKIFITGNKIHNPLDRNHSELRD
    Newman          --MKRSSKSKMSLPKKIFLWVFGILVILAIVAVVYVAAKIFITGNKIHNPLDRNHSELRD
    USA300_FPR3757  ----------MSLPKKIFLWVFGILVILAIVAVVYVAAKIFITGNKIHNPLDRNHSELRD
                              **************************************************

    COL             KKVSLNDGDPFTIALFGVDSDADRKKKGGGERSDSIMILSINPKTKKTEIVSIPRDTRAE
    N315            KKVSLNDGDPFTIALFGVDSDADRKKKGGGERSDSIMILSINPKTKKTEIVSIPRDTRAE
    NCTC8325        KKVSLNDGDPFTIALFGVDSDADRKKKGGGERSDSIMILSINPKTKKTEIVSIPRDTRAE
    Newman          KKVSLNDGDPFTIALFGVDSDADRKKKGGGERSDSIMILSINPKTKKTEIVSIPRDTRAE
    USA300_FPR3757  KKVSLNDGDPFTIALFGVDSDADRKKKGGGERSDSIMILSINPKTKKTEIVSIPRDTRAE
                    ************************************************************

    COL             IVGRGTTEKIAHAYAYGGPNMAVKSLEKLMNVPIDHYATIDMDGLHNMIDSIGGVDVVSN
    N315            IVGRGTTEKIAHAYAYGGPNMAVKSLEKLMNVPIDHYATIDMDGLHNMIDSIGGVDVVSN
    NCTC8325        IVGRGTTEKIAHAYAYGGPNMAVKSLEKLMNVPIDHYATIDMDGLHNMIDSIGGVDVVSN
    Newman          IVGRGTTEKIAHAYAYGGPNMAVKSLEKLMNVPIDHYATIDMDGLHNMIDSIGGVDVVSN
    USA300_FPR3757  IVGRGTTEKIAHAYAYGGPNMAVKSLEKLMNVPIDHYATIDMDGLHNMIDSIGGVDVVSN
                    ************************************************************

    COL             DTFTVDGVRFTKGQQTHVNGDQALKFIRSRKEEGAGGDFGRQQRQQIVLEAMANKIASPS
    N315            DTFTVDGVRFTKGQQTHVNGDQALKFIRSRKEEGAGGDFGRQQRQQIVLEAMANKIASPS
    NCTC8325        DTFTVDGVRFTKGQQTHVNGDQALKFIRSRKEEGAGGDFGRQQRQQIVLEAMANKIASPS
    Newman          DTFTVDGVRFTKGQQTHVNGDQALKFIRSRKEEGAGGDFGRQQRQQIVLEAMANKIASPS
    USA300_FPR3757  DTFTVDGVRFTKGQQTHVNGDQALKFIRSRKEEGAGGDFGRQQRQQIVLEAMANKIASPS
                    ************************************************************

    COL             SITHFNSLMNEIQNNVKTDLTLGDLNTIRSNYKDANDTINKHQLSGQGGIQSDGLYYFIP
    N315            SITHFNSLMNEIQNNVKTDLTLGDLNTIRSNYKDANDTINKHQLSGQGGIQSDGLYYFIP
    NCTC8325        SITHFNSLMNEIQNNVKTDLTLGDLNTIRSNYKDANDTINKHQLSGQGGIQSDGLYYFIP
    Newman          SITHFNSLMNEIQNNVKTDLTLGDLNTIRSNYKDANDTINKHQLSGQGGIQSDGLYYFIP
    USA300_FPR3757  SITHFNSLMNEIQNNVKTDLTLGDLNTIRSNYKDANDTINKHQLSGQGGIQSDGLYYFIP
                    ************************************************************

    COL             SEQSKAESTKLLKDNLE
    N315            SEQSKAESTKLLKDNLE
    NCTC8325        SEQSKAESTKLLKDNLE
    Newman          SEQSKAESTKLLKDNLE
    USA300_FPR3757  SEQSKAESTKLLKDNLE
                    *****************