From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005792000
  • symbol?: spdB
  • description?: Protein of pXO2-46

      descriptions from strain specific annotations:

    • Protein of pXO2-46
    • CAAX amino terminal protease family protein
    • abortive infection protein
    • CAAX amino terminal protease self- immunity family protein
  • strand?: -
  • coordinates?: 5879420..5880152
  • synteny block?: BlockID0045370
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2252
    08BA02176:
    C248_2355
    11819-97:
    MS7_2330
    71193:
    ST398NM01_2364
    ECT-R 2:
    ECTR2_2172
    ED133:
    SAOV_2353c
    ED98:
    SAAV_2375
    HO 5096 0412:
    SAEMRSA15_22110
    JH1:
    SaurJH1_2380
    JH9:
    SaurJH9_2337
    JKD6008:
    SAA6008_02349
    JKD6159:
    SAA6159_02217
    LGA251:
    SARLGA251_20960
    M013:
    M013TW_2270
    MRSA252:
    SAR2397
    MSHR1132:
    SAMSHR1132_21380
    MSSA476:
    SAS2206
    Mu3:
    SAHV_2297
    Mu50:
    SAV2313
    MW2:
    MW2234
    RF122:
    SAB2190c
    ST398:
    SAPIG2364
    T0131:
    SAT0131_02494 (murI)
    TCH60:
    HMPREF0772_10882
    TW20:
    SATW20_24450
    USA300_TCH1516:
    USA300HOU_2296
    VC40:
    SAVC_10430

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MENEKKKYTFKDIAWRDLLIIPIIGVIFYALTIAAYIGPILFGYYEIDSNLIFVATITQA
    N315            MENEKKKYTFKDIAWRDLLIIPIIGVIFYALTIAAYIGPILFGYYEIDSNLIFVATITQA
    NCTC8325        MENEKKKYTFKDIAWRDLLIIPIIGVIFYALTIAAYIGPILFGYYEIDSNLIFVATITQA
    Newman          MENEKKKYTFKDIAWRDLLIIPIIGVIFYALTIAAYIGPILFGYYEIDSNLIFVATITQA
    USA300_FPR3757  MENEKKKYTFKDIAWRDLLIIPIIGVIFYALTIAAYIGPILFGYYEIDSNLIFVATITQA
                    ************************************************************

    COL             LAYTIGIGAFYLFHLKVMPSRLRAGFAYIKKYWLRLSITYIIALILIYTYEYMTQFLPKH
    N315            LAYTIGIGAFYLFHLKVMPSRLRAGFAYIKKYWLRLSITYIIALILIYTYEYMTQFLPKH
    NCTC8325        LAYTIGIGAFYLFHLKVMPSRLRAGFAYIKKYWLRLSITYIIALILIYTYEYMTQFLPKH
    Newman          LAYTIGIGAFYLFHLKVMPSRLRAGFAYIKKYWLRLSITYIIALILIYTYEYMTQFLPKH
    USA300_FPR3757  LAYTIGIGAFYLFHLKVMPSRLRAGFAYIKKYWLRLSITYIIALILIYTYEYMTQFLPKH
                    ************************************************************

    COL             LQYSETANELELNKMFEVPAFLPVAFLLIVIVGPIVEEIVFRHILIGELGKKFNFIAMSI
    N315            LQYSETANELELNKMFEVPAFLPVAFLLIVIVGPIVEEIVFRHILIGELGKKFNFIAMSI
    NCTC8325        LQYSETANELELNKMFEVPAFLPVAFLLIVIVGPIVEEIVFRHILIGELGKKFNFIAMSI
    Newman          LQYSETANELELNKMFEVPAFLPVAFLLIVIVGPIVEEIVFRHILIGELGKKFNFIAMSI
    USA300_FPR3757  LQYSETANELELNKMFEVPAFLPVAFLLIVIVGPIVEEIVFRHILIGELGKKFNFIAMSI
                    ************************************************************

    COL             VSVFLFAFIHVTDAKSPFEFGPYLILSIILVFTYLKSGRNLGSTIALHIANNFVSFVISV
    N315            VSVFLFAFIHVTDAKSPFEFGPYLILSIILVFTYLKSGRNLGSTIALHIANNFVSFVISV
    NCTC8325        VSVFLFAFIHVTDAKSPFEFGPYLILSIILVFTYLKSGRNLGSTIALHIANNFVSFVISV
    Newman          VSVFLFAFIHVTDAKSPFEFGPYLILSIILVFTYLKSGRNLGSTIALHIANNFVSFVISV
    USA300_FPR3757  VSVFLFAFIHVTDAKSPFEFGPYLILSIILVFTYLKSGRNLGSTIALHIANNFVSFVISV
                    ************************************************************

    COL             ISIYA
    N315            ISIYA
    NCTC8325        ISIYA
    Newman          ISIYA
    USA300_FPR3757  ISIYA
                    *****