From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005795000
  • symbol?:
  • description?: RpiR family transcription regulator

      descriptions from strain specific annotations:

    • RpiR family transcription regulator
    • RpiR family phosphosugar-binding transcriptional regulator
    • RpiR family transcriptional regulator
    • RpiR family transcripitonal regulator
    • phosphosugar-binding transcriptional regulator RpiR family protein
    • Transcriptional regulator, RpiR family
    • helix-turn-helix domain, rpiR family protein
    • transcription regulator RpiR family
    • putative transcriptional regulator
    • Sialic acid utilization regulator, RpiR family
    • phosphosugar-binding transcriptional regulator, RpiR family
    • RpiR family regulatory protein
  • strand?: +
  • coordinates?: 5882332..5883213
  • synteny block?: BlockID0045400
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2254
    08BA02176:
    C248_2357
    11819-97:
    MS7_2332
    71193:
    ST398NM01_2366
    ECT-R 2:
    ECTR2_2174
    ED133:
    SAOV_2355
    ED98:
    SAAV_2377
    HO 5096 0412:
    SAEMRSA15_22130
    JH1:
    SaurJH1_2382
    JH9:
    SaurJH9_2339
    JKD6008:
    SAA6008_02351
    JKD6159:
    SAA6159_02219
    LGA251:
    SARLGA251_20980
    M013:
    M013TW_2272
    MRSA252:
    SAR2399
    MSHR1132:
    SAMSHR1132_21400
    MSSA476:
    SAS2208
    Mu3:
    SAHV_2299
    Mu50:
    SAV2315
    MW2:
    MW2236
    RF122:
    SAB2192
    ST398:
    SAPIG2366
    T0131:
    SAT0131_02497 (cudA)
    TCH60:
    HMPREF0772_10880
    TW20:
    SATW20_24470
    USA300_TCH1516:
    USA300HOU_2298
    VC40:
    SAVC_10440

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---MSNVLTEIDSQYPYMTKNEKKIAKFILNSPQKVIKMRSQDLASLLDISTSSVIRFSK
    N315            ---MSNVLTEIDSQYPYMTKNEKKIAKFILNSPQKVIKMRSQDLASLLDISTSSVIRFSK
    NCTC8325        ---MSNVLTEIDSQYPYMTKNEKKIAKFILNSPQKVIKMRSQDLASLLDISTSSVIRFSK
    Newman          ---MSNVLTEIDSQYPYMTKNEKKIAKFILNSPQKVIKMRSQDLASLLDISTSSVIRFSK
    USA300_FPR3757  MINMSNVLTEIDSQYPYMTKNEKKIAKFILNSPQKVIKMRSQDLASLLDISTSSVIRFSK
                       *********************************************************

    COL             KITDGGFHDLKINISKYVPKASSIYNVELMNNESTESLRTKLHTRTTRALNHANNELNDK
    N315            KITDGGFHDLKINISKYVPKASSIYNVELMNNESTESLRTKLHTRTTRALNHANNELNDK
    NCTC8325        KITDGGFHDLKINISKYVPKASSIYNVELMNNESTESLRTKLHTRTTRALNHANNELNDK
    Newman          KITDGGFHDLKINISKYVPKASSIYNVELMNNESTESLRTKLHTRTTRALNHANNELNDK
    USA300_FPR3757  KITDGGFHDLKINISKYVPKASSIYNVELMNNESTESLRTKLHTRTTRALNHANNELNDK
                    ************************************************************

    COL             TIDQICHCLKRSETIFIYGFGASFVVATDLYQKLSRIGLNIQLVQETHIFATLLATHNSN
    N315            TIDQICHCLKRSETIFIYGFGASFVVATDLYQKLSRIGLNIQLVQETHIFATLLATHNSN
    NCTC8325        TIDQICHCLKRSETIFIYGFGASFVVATDLYQKLSRIGLNIQLVQETHIFATLLATHNSN
    Newman          TIDQICHCLKRSETIFIYGFGASFVVATDLYQKLSRIGLNIQLVQETHIFATLLATHNSN
    USA300_FPR3757  TIDQICHCLKRSETIFIYGFGASFVVATDLYQKLSRIGLNIQLVQETHIFATLLATHNSN
                    ************************************************************

    COL             DSVILITNNGTQSEMQSMVKVIDDYHIPIITITSTRDNPVAQASNIVLTYGKTDENEMHM
    N315            DSVILITNNGTQSEMQSMVKVIDDYHIPIITITSTRDNPVAQASNIVLTYGKTDENEMHM
    NCTC8325        DSVILITNNGTQSEMQSMVKVIDDYHIPIITITSTRDNPVAQASNIVLTYGKTDENEMHM
    Newman          DSVILITNNGTQSEMQSMVKVIDDYHIPIITITSTRDNPVAQASNIVLTYGKTDENEMHM
    USA300_FPR3757  DSVILITNNGTQSEMQSMVKVIDDYHIPIITITSTRDNPVAQASNIVLTYGKTDENEMHM
                    ************************************************************

    COL             GATTSLFAQMFTIDILYYRYVALNYHASLDFITQSKMALDNYRKHLSNINFKH
    N315            GATTSLFAQMFTIDILYYRYVALNYHASLDFITQSKMALDNYRKHLSNINFKH
    NCTC8325        GATTSLFAQMFTIDILYYRYVALNYHASLDFITQSKMALDNYRKHLSNINFKH
    Newman          GATTSLFAQMFTIDILYYRYVALNYHASLDFITQSKMALDNYRKHLSNINFKH
    USA300_FPR3757  GATTSLFAQMFTIDILYYRYVALNYHASLDFITQSKMALDNYRKHLSNINFKH
                    *****************************************************