From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005799000
  • symbol?:
  • description?: membrane protein
  • strand?: -
  • coordinates?: 5886090..5886278
  • synteny block?: BlockID0045440
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2258
    08BA02176:
    C248_2361
    11819-97:
    MS7_2336
    71193:
    ST398NM01_2370
    ECT-R 2:
    ECTR2_2178
    ED133:
    SAOV_2359c
    ED98:
    SAAV_2381
    HO 5096 0412:
    SAEMRSA15_22170
    JH1:
    SaurJH1_2386
    JH9:
    SaurJH9_2343
    JKD6008:
    SAA6008_02355
    JKD6159:
    SAA6159_02223
    LGA251:
    SARLGA251_21020
    M013:
    M013TW_2276
    MRSA252:
    SAR2403
    MSHR1132:
    SAMSHR1132_21440
    MSSA476:
    SAS2212
    Mu3:
    SAHV_2303
    Mu50:
    SAV2319
    MW2:
    MW2240
    RF122:
    SAB2196c
    ST398:
    SAPIG2370
    T0131:
    SAT0131_02501
    TCH60:
    HMPREF0772_10876
    TW20:
    SATW20_24510
    USA300_TCH1516:
    VC40:
    SAVC_10460

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MMGYIILFFLAGPVILGVGNLVIGPIFNKQTPFRVQVRSFVVGSMIYLILATIGYFLLLQ
    N315            MMGYIILFFLAGPVILGVGNLVIGPIFNKQTPFRVQVRSFVVGSMIYLILATIGYFLLLQ
    NCTC8325        MMGYIILFFLAGPVILGVGNLVIGPIFNKQTPFRVQVRSFVVGSMIYLILATIGYFLLLQ
    Newman          MMGYIILFFLAGPVILGVGNLVIGPIFNKQTPFRVQVRSFVVGSMIYLILATIGYFLLLQ
                    ************************************************************

    COL             GKL
    N315            GKL
    NCTC8325        GKL
    Newman          GKL
                    ***