From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005802000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 5888171..5888725
  • synteny block?: BlockID0045470
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2261
    08BA02176:
    C248_2364
    11819-97:
    MS7_2339
    71193:
    ST398NM01_2373
    ECT-R 2:
    ECTR2_2181
    ED133:
    SAOV_2362
    ED98:
    SAAV_2384
    HO 5096 0412:
    SAEMRSA15_22200
    JH1:
    SaurJH1_2389
    JH9:
    SaurJH9_2346
    JKD6008:
    SAA6008_02358
    JKD6159:
    SAA6159_02226
    LGA251:
    SARLGA251_21050
    M013:
    M013TW_2279
    MRSA252:
    SAR2407
    MSHR1132:
    SAMSHR1132_21470
    MSSA476:
    SAS2215
    Mu3:
    SAHV_2306
    Mu50:
    SAV2322
    MW2:
    MW2243
    RF122:
    SAB2199
    ST398:
    SAPIG2373
    T0131:
    SAT0131_02504 (nrdG)
    TCH60:
    HMPREF0772_10873
    TW20:
    SATW20_24540
    USA300_TCH1516:
    USA300HOU_2302
    VC40:
    SAVC_10475

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLIDKFETYIINIAGLNDRTTRKKLSKLCKSVQFCDALQFSINKQFNQYVLEISLPKQQL
    N315            MLIDKFETYIINIAGLNDRTTRKKLSKLCKSVQFCDALQFSINKQFNQYVLEISLPKQQL
    NCTC8325        MLIDKFETYIINIAGLNDRTTRKKLSKLCKSVQFCDALQFSINKQFNQYVLEISLPKQQL
    Newman          MLIDKFETYIINIAGLNDRTTRKKLSKLCKSVQFCDALQFSINKQFNQYVLEISLPKQQL
    USA300_FPR3757  MLIDKFETYIINIAGLNDRTTRKKLSKLCKSVQFCDALQFSINKQFNQYVLEISLPKQQL
                    ************************************************************

    COL             PYFISFLSFHQYSIFQVLSPKKINELLDSDNLYQSAKRFDINIDGLQDAFIKDKVIDIMN
    N315            PYFISFLSFHQYSIFQVLSPKKINELLDSDNLYQSAKRFDINIDGLQDAFIKDKVIDIMN
    NCTC8325        PYFISFLSFHQYSIFQVLSPKKINELLDSDNLYQSAKRFDINIDGLQDAFIKDKVIDIMN
    Newman          PYFISFLSFHQYSIFQVLSPKKINELLDSDNLYQSAKRFDINIDGLQDAFIKDKVIDIMN
    USA300_FPR3757  PYFISFLSFHQYSIFQVLSPKKINELLDSDNLYQSAKRFDINIDGLQDAFIKDKVIDIMN
                    ************************************************************

    COL             MFQNHTDITYTLNKSHAHIICTPEIFAKLLHTIATRNIDILSANYRSSSMSKARIS
    N315            MFQNHTDITYTLNKSHAHIICTPEIFAKLLHTIATRNIDILSANYRSSSMSKARIS
    NCTC8325        MFQNHTDITYTLNKSHAHIICTPEIFAKLLHTIATRNIDILSANYRSSSMSKARIS
    Newman          MFQNHTDITYTLNKSHAHIICTPEIFAKLLHTIATRNIDILSANYRSSSMSKARIS
    USA300_FPR3757  MFQNHTDITYTLNKSHAHIICTPEIFAKLLHTIATRNIDILSANYRSSSMSKARIS
                    ********************************************************