From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005811000
  • symbol?:
  • description?: membrane spanning protein

      descriptions from strain specific annotations:

    • membrane spanning protein
    • membrane protein
  • strand?: -
  • coordinates?: 5895516..5896088
  • synteny block?: BlockID0045560
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2266
    08BA02176:
    C248_2370
    11819-97:
    MS7_2345
    71193:
    ST398NM01_2379
    ECT-R 2:
    ECTR2_2187
    ED133:
    SAOV_2367c
    ED98:
    SAAV_2391
    HO 5096 0412:
    SAEMRSA15_22250
    JH1:
    SaurJH1_2395
    JH9:
    SaurJH9_2352
    JKD6008:
    SAA6008_02364
    JKD6159:
    LGA251:
    SARLGA251_21100
    M013:
    M013TW_2285
    MRSA252:
    SAR2412
    MSHR1132:
    SAMSHR1132_21520
    MSSA476:
    SAS2220
    Mu3:
    SAHV_2311
    Mu50:
    SAV2327
    MW2:
    MW2248
    RF122:
    SAB2204c
    ST398:
    SAPIG2379
    T0131:
    SAT0131_02511
    TCH60:
    HMPREF0772_10868
    TW20:
    SATW20_24590
    USA300_TCH1516:
    USA300HOU_2307
    VC40:
    SAVC_10500

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MALIVSRAILFLILALAFGIATVFPEQKLPLYIVFTLFVAVAIVSNVWFTHQNVKKHIIK
    N315            MALIVSRAILFLILALAFGIATVFPEQKLPLYIVFTLFVAVAIIMNVWFTHQNVKKHIIK
    NCTC8325        MALIVSRAILFLILALAFGIATVFPEQKLPLYIVFTLFVAVAIVSNVWFTHQNVKKHIIK
    Newman          MALIVSRAILFLILALAFGIATVFPEQKLPLYIVFTLFVAVAIVSNVWFTHQNVKKHIIK
    USA300_FPR3757  MALIVSRAILFLILALAFGIATVFPEQKLPLYIVFTLFVAVAIVSNVWFTHQNVKKHIIK
                    *******************************************: ***************

    COL             FNKYVAYFLSFVSGLLYIGFVIYTLTIGSYDVLPIIIFAISIVLVQILENILGISIKNTR
    N315            FNKYVAYFLSFVSGLLYIGFVIYTLTIGSYDVLPIIIFAISIVLVQILENILGISIKNTR
    NCTC8325        FNKYVAYFLSFVSGLLYIGFVIYTLTIGSYDVLPIIIFAISIVLVQILENILGISIKNTR
    Newman          FNKYVAYFLSFVSGLLYIGFVIYTLTIGSYDVLPIIIFAISIVLVQILENILGISIKNTR
    USA300_FPR3757  FNKYVAYFLSFVSGLLYIGFVIYTLTIGSYDVLPIIIFAISIVLVQILENILGISIKNTR
                    ************************************************************

    COL             LSNKQLKVISKQRVQQFKVISLILVSVSIVFIFIALMLKWWLLLVISIIVLIIITVAMIV
    N315            LSNKQLKVISKQRVQQFKVISLILVSVSIVFIFIALMLKWWLLLVISIIVLIIITVAMIV
    NCTC8325        LSNKQLKVISKQRVQQFKVISLILVSVSIVFIFIALMLKWWLLLVISIIVLIIITVAMIV
    Newman          LSNKQLKVISKQRVQQFKVISLILVSVSIVFIFIALMLKWWLLLVISIIVLIIITVAMIV
    USA300_FPR3757  LSNKQLKVISKQRVQQFKVISLILVSVSIVFIFIALMLKWWLLLVISIIVLIIITVAMIV
                    ************************************************************

    COL             YEKYYTTPD
    N315            YEKYYTTPD
    NCTC8325        YEKYYTTPD
    Newman          YEKYYTTPD
    USA300_FPR3757  YEKYYTTPD
                    *********