From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005813000
  • symbol?:
  • description?: oxidoreductase

      descriptions from strain specific annotations:

    • oxidoreductase
    • short chain dehydrogenase/reductase oxidoreductase
    • oxidoreductase, short chain dehydrogenase/reductase family protein
    • short chain dehydrogenase/reductase family oxidoreductase
    • dehydrogenase
    • general stress protein 39 (GSP39)
    • putative short chain dehydrogenase
    • short-chain dehydrogenase/reductase SDR
    • short chain dehydrogenase family protein
  • strand?: -
  • coordinates?: 5896705..5897310
  • synteny block?: BlockID0045580
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2267
    08BA02176:
    C248_2371
    11819-97:
    MS7_2346
    71193:
    ST398NM01_2380
    ECT-R 2:
    ECTR2_2188
    ED133:
    SAOV_2368c
    ED98:
    SAAV_2392
    HO 5096 0412:
    SAEMRSA15_22260
    JH1:
    SaurJH1_2396
    JH9:
    SaurJH9_2353
    JKD6008:
    SAA6008_02365
    JKD6159:
    SAA6159_02232
    LGA251:
    SARLGA251_21110
    M013:
    M013TW_2286
    MRSA252:
    SAR2413
    MSHR1132:
    SAMSHR1132_21530
    MSSA476:
    SAS2221
    Mu3:
    SAHV_2312
    Mu50:
    SAV2328
    MW2:
    MW2249
    RF122:
    SAB2205c
    ST398:
    SAPIG2380
    T0131:
    SAT0131_02512
    TCH60:
    HMPREF0772_10867 (gdhII)
    TW20:
    SATW20_24600
    USA300_TCH1516:
    USA300HOU_2308
    VC40:
    SAVC_10505

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAAQDPRTKFKTTDYEKQEQEVPGLQSEMTPAPDCGETSYQGHQRLQGYKILVTGGDSAI
    N315            MATQDPRTKFKTTEYEKQEQEVPGLQSEMTPAPDCGETSYQGHQRLQGYKMLVTGGDSAI
    NCTC8325        MAAQDPRTKFKTTDYEKQEQEVPGLQSEMTPAPDCGETSYQGHQRLQGYKILVTGGDSAI
    Newman          MAAQDPRTKFKTTDYEKQEQEVPGLQSEMTPAPDCGETSYQGHQRLQGYKILVTGGDSAI
    USA300_FPR3757  MAAQDPRTKFKTTDYEKQEQEVPGLQSEMTPAPDCGETSYQGHQRLQGYKILVTGGDSAI
                    **:**********:************************************:*********

    COL             GRAAAIAYAKEGADVAINYLPSEEQDAQEVRQVIEESGQKAVLIPGDIRDEQFNYDLVEQ
    N315            GRAAAIAYAKEGADVAINYLPSEEQDAQEVRQVIEESGQKAVLIPGDIRDEQFNYDLVEQ
    NCTC8325        GRAAAIAYAKEGADVAINYLPSEEQDAQEVRQVIEESGQKAVLIPGDIRDEQFNYDLVEQ
    Newman          GRAAAIAYAKEGADVAINYLPSEEQDAQEVRQVIEESGQKAVLIPGDIRDEQFNYDLVEQ
    USA300_FPR3757  GRAAAIAYAKEGADVAINYLPSEEQDAQEVRQVIEESGQKAVLIPGDIRDEQFNYDLVEQ
                    ************************************************************

    COL             AYQQLGGLDNVTLVAGHQQYHDDIHGFTTEAFTETFETNVYPLFWTVQKALEYLKPGASI
    N315            AYQQLGGLDNVTLVAGHQQYHDDIHGFTTEAFTETFETNVYPLFWTVQKALEYLKPGASI
    NCTC8325        AYQQLGGLDNVTLVAGHQQYHDDIHGFTTEAFTETFETNVYPLFWTVQKALEYLKPGASI
    Newman          AYQQLGGLDNVTLVAGHQQYHDDIHGFTTEAFTETFETNVYPLFWTVQKALEYLKPGASI
    USA300_FPR3757  AYQQLGGLDNVTLVAGHQQYHDDIHGFTTEAFTETFETNVYPLFWTVQKALEYLKPGASI
                    ************************************************************

    COL             TTTSSVQGYNPSPILHDYAASKAAIISLTKSFSEELGPKGIRVNCVAPGPFWSPLQISGG
    N315            TTTSSVQGYNPSPILHDYAASKAAIISLTKSFSEELGPKGIRVNCVAPGPFWSPLQISGG
    NCTC8325        TTTSSVQGYNPSPILHDYAASKAAIISLTKSFSEELGPKGIRVNCVAPGPFWSPLQISGG
    Newman          TTTSSVQGYNPSPILHDYAASKAAIISLTKSFSEELGPKGIRVNCVAPGPFWSPLQISGG
    USA300_FPR3757  TTTSSVQGYNPSPILHDYAASKAAIISLTKSFSEELGPKGIRVNCVAPGPFWSPLQISGG
                    ************************************************************

    COL             QPQSKIPTFGQKTPLGRAGQPVELCGTYVLLASEESSYTTGQVFGVSGGVQID
    N315            QPQSKIPTFGQKTPLGRAGQPVELCGTYVLLASEESSYTTGQVFGVSGGVQID
    NCTC8325        QPQSKIPTFGQKTPLGRAGQPVELCGTYVLLASEESSYTTGQVFGVSGGVQID
    Newman          QPQSKIPTFGQKTPLGRAGQPVELCGTYVLLASEESSYTTGQVFGVSGGVQID
    USA300_FPR3757  QPQSKIPTFGQKTPLGRAGQPVELCGTYVLLASEESSYTTGQVFGVSGGVQID
                    *****************************************************