From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: saupan005834000
  • symbol?:
  • description?: Na+ efflux pump permease-like protein

      descriptions from strain specific annotations:

    • Na+ efflux pump permease-like protein
    • ABC-type Na+ efflux pump, permease component
    • ABC transporter ATP-binding protein
    • ABC-type Na+ efflux pump permease component
    • ABC superfamily ATP binding cassette transporter, membrane protein
    • ABC-2 transporter family protein
    • Na+ efflux pump ABC transporter permease
    • Sodium export permease protein
  • strand?: -
  • coordinates?: 5914703..5915935
  • synteny block?: BlockID0045790
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2279
    08BA02176:
    C248_2383
    11819-97:
    MS7_2359
    71193:
    ST398NM01_2393
    ECT-R 2:
    ECTR2_2201
    ED133:
    SAOV_2382c
    ED98:
    SAAV_2405
    HO 5096 0412:
    SAEMRSA15_22370
    JH1:
    SaurJH1_2410
    JH9:
    SaurJH9_2365
    JKD6008:
    SAA6008_02378
    JKD6159:
    SAA6159_02244
    LGA251:
    SARLGA251_21230
    M013:
    M013TW_2298
    MRSA252:
    SAR2426
    MSHR1132:
    SAMSHR1132_21650
    MSSA476:
    SAS2232
    Mu3:
    SAHV_2324
    Mu50:
    SAV2340
    MW2:
    MW2260
    RF122:
    SAB2218c
    ST398:
    SAPIG2393
    T0131:
    SAT0131_02527
    TCH60:
    HMPREF0772_10853
    TW20:
    SATW20_24720
    USA300_TCH1516:
    USA300HOU_2322
    VC40:
    SAVC_10565

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MHKFWATFTLTYIKKIKAKSFVIFMIIIAALMIGLSNIDKIINMFDDGPDKIGVAAPNEQ
    N315            MHKFWATFTLTYIKKIKAKSFVIFMIIIAALMIGLSNIDKIINMFDDGPDKIGVAAPNEQ
    NCTC8325        MHKFWATFTLTYIKKIKAKSFVIFMIIIAALMIGLSNIDKIINMFDDGPDKIGVAAPNEQ
    Newman          MHKFWATFTLTYIKKIKAKSFVIFMIIIAALMIGLSNIDKIINMFDDGPDKIGVAAPNEQ
    USA300_FPR3757  MHKFWATFTLTYIKKIKAKSFVIFMIIIAALMIGLSNIDKIINMFDDGPDKIGVAAPNEQ
                    ************************************************************

    COL             IYKVFKQQANTFHSDAKFTKVSIEDAEKEVKKHKLDKAYIIKVNQNRTLQGTIISEKRVS
    N315            IYKVFKQQANTFHSDAKFTKVSIEDAEKEVKKHKLDKAYIIKVNQNRTLQGTIISEKRVS
    NCTC8325        IYKVFKQQANTFHSDAKFTKVSIEDAEKEVKKHKLDKAYIIKVNQNRTLQGTIISEKRVS
    Newman          IYKVFKQQANTFHSDAKFTKVSIEDAEKEVKKHKLDKAYIIKVNQNRTLQGTIISEKRVS
    USA300_FPR3757  IYKVFKQQANTFHSDAKFTKVSIEDAEKEVKKHKLDKAYIIKVNQNRTLQGTIISEKRVS
                    ************************************************************

    COL             HEDSQKVQALLTAIQTNMVAGELNINKEDLQKLQAQSKVDNKVISNDEVDKVSEGQKIFN
    N315            HEDSQKVQALLTAIQTNMVAGELNINKEDLQKLQAQSKVDNKVISNDEVDKVSEGQKIFN
    NCTC8325        HEDSQKVQALLTAIQTNMVAGELNINKEDLQKLQAQSKVDNKVISNDEVDKVSEGQKIFN
    Newman          HEDSQKVQALLTAIQTNMVAGELNINKEDLQKLQAQSKVDNKVISNDEVDKVSEGQKIFN
    USA300_FPR3757  HEDSQKVQALLTAIQTNMVAGELNINKEDLQKLQAQSKVDNKVISNDEVDKVSEGQKIFN
                    ************************************************************

    COL             YALAYGIIFLMFFIVLNYASQIAMEIASEKTSRVIEMIITSISPIQHIFAKILGVIAVAV
    N315            YALAYGIIFLMFFIVLNYASQIAMEIASEKTSRVIEMIITSISPIQHIFAKILGVIAVAV
    NCTC8325        YALAYGIIFLMFFIVLNYASQIAMEIASEKTSRVIEMIITSISPIQHIFAKILGVIAVAV
    Newman          YALAYGIIFLMFFIVLNYASQIAMEIASEKTSRVIEMIITSISPIQHIFAKILGVIAVAV
    USA300_FPR3757  YALAYGIIFLMFFIVLNYASQIAMEIASEKTSRVIEMIITSISPIQHIFAKILGVIAVAV
                    ************************************************************

    COL             TQIILIVLMAVICIFAFDLKDLLQGFNVEMNQLSWQIIIVGIISSIVGITAYVLLAAILG
    N315            TQIILIVLMAVICIFAFDLKDLLQGFNVEMNQLSWQIIIVGIISSIVGIMAYVLLAAILG
    NCTC8325        TQIILIVLMAVICIFAFDLKDLLQGFNVEMNQLSWQIIIVGIISSIVGITAYVLLAAILG
    Newman          TQIILIVLMAVICIFAFDLKDLLQGFNVEMNQLSWQIIIVGIISSIVGITAYVLLAAILG
    USA300_FPR3757  TQIILIVLMAVICIFAFDLKDLLQGFNVEMNQLSWQIIIVGIISSIVGITAYVLLAAILG
                    ************************************************* **********

    COL             SLTSRIEDLNQSLMPLTLLGMIAFYIAIFTINNPDGQLALITSYIPFLAPFQLVVRAQTS
    N315            SLTSRIEDLNQSLMPLTLLGMIAFYIAIFTINNPDGQLALITSYIPFLAPFQLVVRAQTS
    NCTC8325        SLTSRIEDLNQSLMPLTLLGMIAFYIAIFTINNPDGQLALITSYIPFLAPFQLVVRAQTS
    Newman          SLTSRIEDLNQSLMPLTLLGMIAFYIAIFTINNPDGQLALITSYIPFLAPFQLVVRAQTS
    USA300_FPR3757  SLTSRIEDLNQSLMPLTLLGMIAFYIAIFTINNPDGQLALITSYIPFLAPFQLVVRAQTS
                    ************************************************************

    COL             GLQIYEVILSSLISIVMVAVLIWIAIKTYKDSVLTFERGLFNSMKRVFKK
    N315            GLQIYEVILSSLISIVMVAVLIWIAIKTYKDSVLTFERGLFNSMKRVFKK
    NCTC8325        GLQIYEVILSSLISIVMVAVLIWIAIKTYKDSVLTFERGLFNSMKRVFKK
    Newman          GLQIYEVILSSLISIVMVAVLIWIAIKTYKDSVLTFERGLFNSMKRVFKK
    USA300_FPR3757  GLQIYEVILSSLISIVMVAVLIWIAIKTYKDSVLTFERGLFNSMKRVFKK
                    **************************************************