From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005841000
  • symbol?:
  • description?: 3-methyladenine DNA glycosylate

      descriptions from strain specific annotations:

    • 3-methyladenine DNA glycosylate
    • 3-methylpurine glycosylase
    • DNA-3-methyladenine glycosylase
    • DNA-3-methyladenine glycosylase II
    • DNA-3-methyladenine glycosylase family protein
    • putative 3-methyladenine DNA glycosylase
    • putative 3-methylpurine glycosylase
  • strand?: +
  • coordinates?: 5918129..5918737
  • synteny block?: BlockID0045860
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2283
    08BA02176:
    C248_2386
    11819-97:
    MS7_2362
    71193:
    ST398NM01_2396
    ECT-R 2:
    ECTR2_2204
    ED133:
    SAOV_2386
    ED98:
    SAAV_2408
    HO 5096 0412:
    SAEMRSA15_22420
    JH1:
    SaurJH1_2414
    JH9:
    SaurJH9_2368
    JKD6008:
    SAA6008_02381
    JKD6159:
    SAA6159_02247
    LGA251:
    SARLGA251_21260
    M013:
    M013TW_2301
    MRSA252:
    SAR2429
    MSHR1132:
    SAMSHR1132_21680
    MSSA476:
    SAS2235
    Mu3:
    SAHV_2328
    Mu50:
    SAV2344
    MW2:
    MW2265
    RF122:
    SAB2222
    ST398:
    SAPIG2396
    T0131:
    SAT0131_02530
    TCH60:
    HMPREF0772_10850 (mag)
    TW20:
    SATW20_24750
    USA300_TCH1516:
    USA300HOU_2325
    VC40:
    SAVC_10580

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDFVNNDTRQIAKNLLGVKVIYQDTTQTYTGYIVETEAYLGLNDRAAHGYGGKITPKVTS
    N315            MDFVNNDTRQIAKNLLGVKVIYQDTTQTYTGYIVETEAYLGLNDRAAHGYGGKITPKVTS
    NCTC8325        MDFVNNDTRQIAKNLLGVKVIYQDTTQTYTGYIVETEAYLGLNDRAAHGYGGKITPKVTS
    Newman          MDFVNNDTRQIAKNLLGVKVIYQDTTQTYTGYIVETEAYLGLNDRAAHGYGGKITPKVTS
    USA300_FPR3757  MDFVNNDTRQIAKNLLGVKVIYQDTTQTYTGYIVETEAYLGLNDRAAHGYGGKITPKVTS
                    ************************************************************

    COL             LYKRGGTIYAHVMHTHLLINFVTKSEGIPEGVLIRAIEPEEGLSAMFRNRGKKGYEVTNG
    N315            LYKRGGTIYAHVMHTHLLINFVTKSEGIPEGVLIRAIEPEEGLSAMFRNRGKKGYEVTNG
    NCTC8325        LYKRGGTIYAHVMHTHLLINFVTKSEGIPEGVLIRAIEPEEGLSAMFRNRGKKGYEVTNG
    Newman          LYKRGGTIYAHVMHTHLLINFVTKSEGIPEGVLIRAIEPEEGLSAMFRNRGKKGYEVTNG
    USA300_FPR3757  LYKRGGTIYAHVMHTHLLINFVTKSEGIPEGVLIRAIEPEEGLSAMFRNRGKKGYEVTNG
                    ************************************************************

    COL             PGKWTKAFNIPRAIDGATLNDCRLSIDTKNRKYPKDIIASPRIGIPNKGDWTHKSLRYTV
    N315            PGKWTKAFNIPRAIDGATLNDCRLSIDTKNRKYPKDIIASPRIGIPNKGDWTHKSLRYTV
    NCTC8325        PGKWTKAFNIPRAIDGATLNDCRLSIDTKNRKYPKDIIASPRIGIPNKGDWTHKSLRYTV
    Newman          PGKWTKAFNIPRAIDGATLNDCRLSIDTKNRKYPKDIIASPRIGIPNKGDWTHKSLRYTV
    USA300_FPR3757  PGKWTKAFNIPRAIDGATLNDCRLSIDTKNRKYPKDIIASPRIGIPNKGDWTHKSLRYTV
                    ************************************************************

    COL             KGNPFVSRMRKSDCMFPEDTWK
    N315            KGNPFVSRMRKSDCMFPEDTWK
    NCTC8325        KGNPFVSRMRKSDCMFPEDTWK
    Newman          KGNPFVSRMRKSDCMFPEDTWK
    USA300_FPR3757  KGNPFVSRMRKSDCMFPEDTWK
                    **********************