From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005850000
  • symbol?:
  • description?: membrane protein
  • strand?: +
  • coordinates?: 5926547..5927194
  • synteny block?: BlockID0045950
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2290
    08BA02176:
    C248_2394
    11819-97:
    MS7_2369
    71193:
    ST398NM01_2403
    ECT-R 2:
    ECTR2_2211
    ED133:
    SAOV_2394
    ED98:
    SAAV_2415
    HO 5096 0412:
    SAEMRSA15_22490
    JH1:
    SaurJH1_2421
    JH9:
    SaurJH9_2375
    JKD6008:
    SAA6008_02388
    JKD6159:
    SAA6159_02255
    LGA251:
    SARLGA251_21330
    M013:
    M013TW_2308
    MRSA252:
    SAR2436
    MSHR1132:
    SAMSHR1132_21750
    MSSA476:
    SAS2242
    Mu3:
    SAHV_2335
    Mu50:
    SAV2351
    MW2:
    MW2272
    RF122:
    SAB2230
    ST398:
    SAPIG2403
    T0131:
    SAT0131_02537
    TCH60:
    HMPREF0772_10843
    TW20:
    SATW20_24820
    USA300_TCH1516:
    USA300HOU_2332
    VC40:
    SAVC_10615

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTNPNQRLEPFDETFQQPNIHRGKRYGKKKRSLVSMIIQIIVVILTAIAGYSMWKQPIFN
    N315            MTNPNQRLEPFDETFQQPNIHRGKRYGKKKRSLVSMIIQIIVVILTAIAGYSMWKQPIFN
    NCTC8325        MTNPNQRLEPFDETFQQPNIHRGKRYGKKKRSLVSMIIQIIVVILTTIAGYSMWKQPIFN
    Newman          MTNPNQRLEPFDETFQQPNIHRGKRYGKKKRSLVSMIIQIIVVILTAIAGYSMWKQPIFN
    USA300_FPR3757  MTNPNQRLEPFDETFQQPNIHRGKRYGKKKRSLVSMIIQIIVVILTAIAGYSMWKQPIFN
                    **********************************************:*************

    COL             IVFTKESVDFDGIKNFNETIGKMHQLNINLGNINDLQQGIDRLILVFNGFFILCIVSLVI
    N315            IVFTKESVDFDGIKNFNETIGKMHQLNINLGNINDLQQGIDRLILVFNGFFILCIVSLVI
    NCTC8325        IVFTKESVDFDGIKNFNETIGKMHQLNINLGNINDLQQGIDRLILVFNGFFILCIVSLVI
    Newman          IVFTKESVDFDGIKNFNETIGKMHQLNINLGNINDLQQGIDRLILVFNGFFILCIVSLVI
    USA300_FPR3757  IVFTKESVDFDGIKNFNETIGKMHQLNINLGNINDLQQGIDRLILVFNGFFILCIVSLVI
                    ************************************************************

    COL             TILTIVFNRTVLKVVNILVLTIMLVITLYFSYIIKALAQEIADVFKKYYLNVPPDQVITE
    N315            TILTIVFNRTVLKVVNILVLTIMLVITLYFSYIIKTLAQEIADALKKYYLNVPPDQVITE
    NCTC8325        TILTIVFNRTVLKVVNILVLTIMLVITLYFSYIIKALAQEIADVFKKYYLNVPPDQVITE
    Newman          TILTIVFNRTVLKVVNILVLTIMLVITLYFSYIIKALAQEIADVFKKYYLNVPPDQVITE
    USA300_FPR3757  TILTIVFNRTVLKVVNILVLTIMLVITLYFSYIIKALAQEIADVFKKYYLNVPPDQVITE
                    ***********************************:*******.:***************

    COL             ADAIHNGIILLGCSIGLLVISLFFRNRMPRLK
    N315            ADAIHNGIILLGCSIGLLVISLFFRNRMPRLK
    NCTC8325        ADAIHNGIILLGCSIGLLVISLFFRNRMPRLK
    Newman          ADAIHNGIILLGCSIGLLVISLFFRNRMPRLK
    USA300_FPR3757  ADAIHNGIILLGCSIGLLVISLFFRNRMPRLK
                    ********************************