From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005853000
  • symbol?:
  • description?: HlyD family secretion protein

      descriptions from strain specific annotations:

    • HlyD family secretion protein
    • Drug transporter, putative
    • exported multidrug resistance protein
    • hlyD secretion family protein
    • multidrug resistance efflux pump-like protein
    • Multidrug resistance protein (function not yet clear)
    • multidrug resistance protein A, drug resistance transporter
  • strand?: -
  • coordinates?: 5930688..5931326
  • synteny block?: BlockID0045980
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2292
    08BA02176:
    C248_2397
    11819-97:
    MS7_2371
    71193:
    ST398NM01_2405
    ECT-R 2:
    ECTR2_2213
    ED133:
    SAOV_2396c
    ED98:
    SAAV_2417
    HO 5096 0412:
    SAEMRSA15_22510
    JH1:
    SaurJH1_2423
    JH9:
    SaurJH9_2377
    JKD6008:
    SAA6008_02390 (emrA)
    JKD6159:
    SAA6159_02257 (emrA)
    LGA251:
    SARLGA251_21350
    M013:
    M013TW_2310
    MRSA252:
    SAR2438
    MSHR1132:
    SAMSHR1132_21780
    MSSA476:
    SAS2244
    Mu3:
    SAHV_2337
    Mu50:
    SAV2353
    MW2:
    MW2274
    RF122:
    SAB2232c
    ST398:
    SAPIG2405
    T0131:
    SAT0131_02540
    TCH60:
    HMPREF0772_10841
    TW20:
    SATW20_24840
    USA300_TCH1516:
    USA300HOU_2334
    VC40:
    SAVC_10625

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKMILINVITVVVLLAIGIAGFYFWNKTTSYVTTDNAKVNGDQIKIASPASGQIKSLNV
    N315            MKKMILINVITVVVLLAIGIAGFYFWNKTTSYVTTDNAKVNGDQIKIASPASGQIKSLNV
    NCTC8325        MKKMILINVITVVVLLAIGIAGFYFWNKTTSYVTTDNAKVNGDQIKIASPASGQIKSLNV
    Newman          MKKMILINVITVVVLLAIGIAGFYFWNKTTSYVTTDNAKVNGDQIKIASPASGQIKSLNV
    USA300_FPR3757  MKKMILINVITVVVLLAIGIAGFYFWNKTTSYVTTDNAKVNGDQIKIASPASGQIKSLNV
                    ************************************************************

    COL             KQGDKLDKGDKVAIVTVQGQDGETKDMDLKMPQKGTIAKLDGMEGSMVQAGNPIAYAYNL
    N315            KQGDKLDKGDKVATVTVQGQDGETKDMDLKMPQKGTIAKLDGMEGSMVQAGNPIAYAYNL
    NCTC8325        KQGDKLDKGDKVAIVTVQGQDGETKDMDLKMPQKGTIAKLDGMEGSMVQAGNPIAYAYNL
    Newman          KQGDKLDKGDKVAIVTVQGQDGETKDMDLKMPQKGTIAKLDGMEGSMVQAGNPIAYAYNL
    USA300_FPR3757  KQGDKLDKGDKVAIVTVQGQDGETKDMDLKMPQKGTIAKLDGMEGSMVQAGNPIAYAYNL
                    ************* **********************************************

    COL             DDLYVTANIDEKDIKDVEVGKDVDVTIDGQKASIKGKVDSIGKATAASFSLMPSSNSDGN
    N315            DDLYVTANIDEKDIKDVEVGKDVDVTIDGQKASIKGKVDSIGKATAASFSLMPSSNSDGN
    NCTC8325        DDLYVTANIDEKDIKDVEVGKDVDVTIDGQKASIKGKVDSIGKATAASFSLMPSSNSDGN
    Newman          DDLYVTANIDEKDIKDVEVGKDVDVTIDGQKASIKGKVDSIGKATAASFSLMPSSNSDGN
    USA300_FPR3757  DDLYVTANIDEKDIKDVEVGKDVDVTIDGQKASIKGKVDSIGKATAASFSLMPSSNSDGN
                    ************************************************************

    COL             YTKVSQVIPVKITLESEPSKQVVPGMNAEVKIHKN
    N315            YTKVSQVIPVKITLESEPSKQVVPGMNAEVKIHKN
    NCTC8325        YTKVSQVIPVKITLESEPSKQVVPGMNAEVKIHKN
    Newman          YTKVSQVIPVKITLESEPSKQVVPGMNAEVKIHKN
    USA300_FPR3757  YTKVSQVIPVKITLESEPSKQVVPGMNAEVKIHKN
                    ***********************************