From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005868000
  • symbol?: hrtA
  • description?: hemin ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • hemin ABC transporter ATP-binding protein
    • ABC transporter ATP-binding protein
    • hemin import ATP-binding protein
    • ABC superfamily ATP binding cassette transporter, ABC protein
    • ABC transporter, ATP-binding protein
    • ATP-binding ABC transporter
    • cobQ/CobB/MinD/ParA nucleotide binding domain protein
    • Heme efflux system ATPase HrtA
    • macrolide export ATP-binding/permease protein macB . domain protein
    • Putative hemin import ATP-binding protein hrtA
  • strand?: -
  • coordinates?: 5940544..5941209
  • synteny block?: BlockID0046130
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2298 (hrtA)
    08BA02176:
    C248_2404
    11819-97:
    MS7_2377
    71193:
    ST398NM01_2412
    ECT-R 2:
    ECTR2_2219
    ED133:
    SAOV_2403c
    ED98:
    SAAV_2424
    HO 5096 0412:
    SAEMRSA15_22570
    JH1:
    SaurJH1_2429
    JH9:
    SaurJH9_2383
    JKD6008:
    SAA6008_02397
    JKD6159:
    SAA6159_02263
    LGA251:
    SARLGA251_21420
    M013:
    M013TW_2317
    MRSA252:
    SAR2445
    MSHR1132:
    SAMSHR1132_21840
    MSSA476:
    SAS2250
    Mu3:
    SAHV_2343
    Mu50:
    SAV2359
    MW2:
    MW2280
    RF122:
    SAB2238c
    ST398:
    SAPIG2412
    T0131:
    SAT0131_02547 (mraW)
    TCH60:
    HMPREF0772_10833
    TW20:
    SATW20_24910
    USA300_TCH1516:
    USA300HOU_2342 (htrB)
    VC40:
    SAVC_10665

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MALVVEDIVKNFGEGLSETKVLKGINFEVEQGEFVILNGASGSGKTTLLTILGGLLSQTS
    N315            MALVVKDIVKNFGEGLSETKVLKGINFEVEQGEFVILNGASGSGKTTLLTILGGLLSQTS
    NCTC8325        MALVVEDIVKNFGEGLSETKVLKGINFEVEQGEFVILNGASGSGKTTLLTILGGLLSQTS
    Newman          MALVVEDIVKNFGEGLSETKVLKGINFEVEQGEFVILNGASGSGKTTLLTILGGLLSQTS
    USA300_FPR3757  MALVVEDIVKNFGEGLSETKVLKGINFEVEQGEFVILNGASGSGKTTLLTILGGLLSQTS
                    *****:******************************************************

    COL             GTVLYNDAPLFDKQHRPSDLRLEDIGFIFQSSHLVPYLKVIEQLTLVGQEAGMTKQQSST
    N315            GTVLYNDAPLFDKQHRPSDLRLEDIGFIFQSSHLVPYLKVIEQLTLVGQEAGMTKQQSST
    NCTC8325        GTVLYNDAPLFDKQHRPSDLRLEDIGFIFQSSHLVPYLKVIEQLTLVGQEAGMTKQQSST
    Newman          GTVLYNDAPLFDKQHRPSDLRLEDIGFIFQSSHLVPYLKVIEQLTLVGQEAGMTKQQSST
    USA300_FPR3757  GTVLYNDAPLFDKQHRPSDLRLEDIGFIFQSSHLVPYLKVIEQLTLVGQEAGMTKQQSST
                    ************************************************************

    COL             RAIQLLKNIGLEDRLNVYPHQLSGGEKQRVAIMRAFMNNPKIILADEPTASLDADRATKV
    N315            RAIQLLKNIGLEDRLNVYPHQLSGGEKQRVAIMRAFMNNPKIILADEPTASLDADRATKV
    NCTC8325        RAIQLLKNIGLEDRLNVYPHQLSGGEKQRVAIMRAFMNNPKIILADEPTASLDADRATKV
    Newman          RAIQLLKNIGLEDRLNVYPHQLSGGEKQRVAIMRAFMNNPKIILADEPTASLDADRATKV
    USA300_FPR3757  RAIQLLKNIGLEDRLNVYPHQLSGGEKQRVAIMRAFMNNPKIILADEPTASLDADRATKV
                    ************************************************************

    COL             VEMIRQQIKEQQMIGIMITHDRRLFEYADRVIELEDGKITD
    N315            VEMIRQQIKEQQMIGIMITHDRRLFEYADRVIELEDGKITD
    NCTC8325        VEMIRQQIKEQQMIGIMITHDRRLFEYADRVIELEDGKITD
    Newman          VEMIRQQIKEQQMIGIMITHDRRLFEYADRVIELEDGKITD
    USA300_FPR3757  VEMIRQQIKEQQMIGIMITHDRRLFEYADRVIELEDGKITD
                    *****************************************