From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005870000
  • symbol?: hssR
  • description?: DNA-binding response regulator

      descriptions from strain specific annotations:

    • DNA-binding response regulator
    • response regulator protein
    • heme response regulator HssR
    • two component response regulator
    • hemin DNA-binding response regulator
    • response regulator receiver
    • Two-component response regulator colocalized with HrtAB transporter
    • two component transcriptional regulator
    • winged helix family two component transcriptional regulator
  • strand?: +
  • coordinates?: 5942373..5943074
  • synteny block?: BlockID0046150
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2300
    08BA02176:
    C248_2406
    11819-97:
    MS7_2379 (hssR)
    71193:
    ST398NM01_2414
    ECT-R 2:
    ECTR2_2221
    ED133:
    SAOV_2405
    ED98:
    SAAV_2426
    HO 5096 0412:
    SAEMRSA15_22590
    JH1:
    SaurJH1_2431
    JH9:
    SaurJH9_2385
    JKD6008:
    SAA6008_02399 (hssR)
    JKD6159:
    SAA6159_02265 (hssR)
    LGA251:
    SARLGA251_21440 (hssR)
    M013:
    M013TW_2319
    MRSA252:
    SAR2447
    MSHR1132:
    SAMSHR1132_21860
    MSSA476:
    SAS2252
    Mu3:
    SAHV_2345
    Mu50:
    SAV2361
    MW2:
    MW2282
    RF122:
    SAB2240
    ST398:
    SAPIG2414
    T0131:
    SAT0131_02549 (spc)
    TCH60:
    HMPREF0772_10831 (regX)
    TW20:
    SATW20_24930 (hssR)
    USA300_TCH1516:
    USA300HOU_2344 (hssR)
    VC40:
    SAVC_10675

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVQCLVVDDDPRILNYIASHLQIEHIDAYTQPSGEAALKLLEKQRVDIAVVDIMMDGMDG
    N315            MVQCLVVDDDPRILNYIASHLQTEHIDAYTQPSGEAALKLLEKQRVDIAVVDIMMDGMDG
    NCTC8325        MVQCLVVDDDPRILNYIASHLQTEHIDAYTQPSGEAALKLLEKQRVDIAVVDIMMDGMDG
    Newman          MVQCLVVDDDPRILNYIASHLQIEHIDAYTQPSGEAALKLLEKQRVDIAVVDIMMDGMDG
    USA300_FPR3757  MVQCLVVDDDPRILNYIASHLQTEHIDAYTQPSGEAALKLLEKQRVDIAVVDIMMDGMDG
                    ********************** *************************************

    COL             FQLCNTLKNDYDIPVIMLTARDALSDKERAFISGTDDYVTKPFEVKELIFRIRAVLRRYN
    N315            FQLCNTLKNDYDIPVIMLTARDALSDKERAFISGTDDYVTKPFEVKELIFRIRAVLRRYN
    NCTC8325        FQLCNTLKNDYDIPVIMLTARDALSDKERAFISGTDDYVTKPFEVKELIFRIRAVLRRYN
    Newman          FQLCNTLKNDYDIPVIMLTARDALSDKERAFISGTDDYVTKPFEVKELIFRIRAVLRRYN
    USA300_FPR3757  FQLCNTLKNDYDIPVIMLTARDALSDKERAFISGTDDYVTKPFEVKELIFRIRAVLRRYN
                    ************************************************************

    COL             INSNSEMTIGNLTLNQSYLELQVSNKTMTLPNKEFQLLFMLAARPKQIFTREQIIEKIWG
    N315            INSNSEMTIGNLTLNQSYLELQVSNKTMTLPNKEFQLLFMLAARPKQIFTREQIIEKIWG
    NCTC8325        INSNSEMTIGNLTLNQSYLELQVSNKTMTLPNKEFQLLFMLAARPKQIFTREQIIEKIWG
    Newman          INSNSEMTIGNLTLNQSYLELQVSNKTMTLPNKEFQLLFMLAARPKQIFTREQIIEKIWG
    USA300_FPR3757  INSNSEMTIGNLTLNQSYLELQVSNKTMTLPNKEFQLLFMLAARPKQIFTREQIIEKIWG
                    ************************************************************

    COL             YDYEGDERTVDVHIKRLRQRLKKLNATLTIETVRGQGYKVENHV
    N315            YDYEGDERTVDVHIKRLRQRLKKLNATLTIETVRGQGYKVENHV
    NCTC8325        YDYEGDERTVDVHIKRLRQRLKKLNATLTIETVRGQGYKVENHV
    Newman          YDYEGDERTVDVHIKRLRQRLKKLNATLTIETVRGQGYKVENHV
    USA300_FPR3757  YDYEGDERTVDVHIKRLRQRLKKLNATLTIETVRGQGYKVENHV
                    ********************************************