From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005880000
  • symbol?:
  • description?: Putative glycosyl/glycerophosphate transferase in teichoic acid biosynthesis

      descriptions from strain specific annotations:

    • Putative glycosyl/glycerophosphate transferase in teichoic acid biosynthesis
    • tagF domain protein
    • Glycosyl/glycerophosphate transferase in teichoic acid biosynthesis protein
    • Poly(glycerophosphate) glycerophosphotransferase family protein
  • strand?: +
  • coordinates?: 5953283..5954971
  • synteny block?: BlockID0046250
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2306
    08BA02176:
    C248_2413
    11819-97:
    MS7_2385
    71193:
    ST398NM01_2420
    ECT-R 2:
    ECTR2_2227
    ED133:
    SAOV_2414
    ED98:
    SAAV_2432
    HO 5096 0412:
    SAEMRSA15_22680
    JH1:
    SaurJH1_2437
    JH9:
    SaurJH9_2391
    JKD6008:
    SAA6008_02405
    JKD6159:
    SAA6159_02271
    LGA251:
    SARLGA251_21530
    M013:
    M013TW_2328
    MRSA252:
    SAR2456
    MSHR1132:
    SAMSHR1132_21950
    MSSA476:
    SAS2258
    Mu3:
    SAHV_2351
    Mu50:
    SAV2367
    MW2:
    MW2288
    RF122:
    SAB2247
    ST398:
    SAPIG2420
    T0131:
    SAT0131_02557
    TCH60:
    HMPREF0772_10822
    TW20:
    SATW20_24990
    USA300_TCH1516:
    USA300HOU_2350
    VC40:
    SAVC_10705

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIKQINVSNMQKFESQLMKAQSEGYTHVVPYANEIMIYQSMLDAVQLYPKSIVVDYTVDG
    N315            MIKQINVSNMQKFESQLMKAQSEGYTHVVPYANEIMIYQSMLDAVQLYPKSIVVDYTVDG
    NCTC8325        MIKQINVSNMQKFESQLMKAQSEGYTHVVPYANEIMIYQSMLDAVQLYPKSIVVDYTVDG
    Newman          MIKQINVSNMQKFESQLMKAQSEGYTHVVPYANEIMIYQSMLDAVQLYPKSIVVDYTVDG
    USA300_FPR3757  MIKQINVSNMQKFESQLMKAQSEGYTHVVPYANEIMIYQSMLDAVQLYPKSIVVDYTVDG
                    ************************************************************

    COL             QYKNDCHYFGQSSINIADWAQNNNYYPNLIYAIQQTLDLIHYYSVETIFDLALLTLLKGD
    N315            QYKNDCHYFGQSSINIADWAQNNNYYPNLIYAIQQTLDLIHYYSVETIFDLALLTLLKGD
    NCTC8325        QYKNDCHYFGQSSINIADWAQNNNYYPNLIYAIQQTLDLIHYYSVETIFDLALLTLLKGD
    Newman          QYKNDCHYFGQSSINIADWAQNNNYYPNLIYAIQQTLDLIHYYSVETIFDLALLTLLKGD
    USA300_FPR3757  QYKNDCHYFGQSSINIADWAQNNNYYPNLIYAIQQTLDLIHYYSVETIFDLALLTLLKGD
                    ************************************************************

    COL             LSIDGHVVFDFKAPIATSASIWETIKTIEDFDMMSQFYLNKMAYIDHHPIPFRNLFIEDS
    N315            LSIDGHVVFDFKAPIATSASIWETIKTIEDFDMMSQFYLNKMAYIDHHPIPFRNLFIEDS
    NCTC8325        LSIDGHVVFDFKAPIATSASIWETIKTIEDFDMMSQFYLNKMAYIDHHPIPFRNLFIEDS
    Newman          LSIDGHVVFDFKAPIATSASIWETIKTIEDFDMMSQFYLNKMAYIDHHPIPFRNLFIEDS
    USA300_FPR3757  LSIDGHVVFDFKAPIATSASIWETIKTIEDFDMMSQFYLNKMAYIDHHPIPFRNLFIEDS
                    ************************************************************

    COL             EQLNSPDNWLYSTKFMLPKWLYKIAKQRADNKQLQNFGLYTKQPNVLKDHIVFIGDHHQY
    N315            EQLNSPDNWLYSTKFMLPKWLYKIAKQRADNKQLQNFGLYTKQPNVLKDHIVFIGDHHQY
    NCTC8325        EQLNSPDNWLYSTKFMLPKWLYKIAKQRADNKQLQNFGLYTKQPNVLKDHIVFIGDHHQY
    Newman          EQLNSPDNWLYSTKFMLPKWLYKIAKQRADNKQLQNFGLYTKQPNVLKDHIVFIGDHHQY
    USA300_FPR3757  EQLNSPDNWLYSTKFMLPKWLYKIAKQRADNKQLQNFGLYTKQPNVLKDHIVFIGDHHQY
                    ************************************************************

    COL             IGNSKYLFTYFVKHNPMTACYFVTDDRRGPHFISPKSEKADELINSARVVIVENDIPETL
    N315            IGNSKYLFTYFVKHNPMTACYFVTDDRRGPHFISPKSEKADELINSARVVIVENDIPETL
    NCTC8325        IGNSKYLFTYFVKHNPMTACYFVTDDRRGPHFISPKSEKADELINSARVVIVENDIPETL
    Newman          IGNSKYLFTYFVKHNPMTACYFVTDDRRGPHFISPKSEKADELINSARVVIVENDIPETL
    USA300_FPR3757  IGNSKYLFTYFVKHNPMTACYFVTDDRRGPHFISPKSEKADELINSARVVIVENDIPETL
                    ************************************************************

    COL             QPNGTLIQLHQGTPIMQLFLDSKEPIKNIETPFYRAKRYNRWLQFDYVIHSADDISHFYQ
    N315            QPNGTLIQLHQGTPIMQLFLDSKEPIKNIETPFYRAKRYNRWLQFDYVIHSADDISHFYQ
    NCTC8325        QPNGTLIQLHQGTPIMQLFLDSKEPIKNIETPFYRAKRYNRWLQFDYVIHSADDISHFYQ
    Newman          QPNGTLIQLHQGTPIMQLFLDSKEPIKNIETPFYRAKRYNRWLQFDYVIHSADDISHFYQ
    USA300_FPR3757  QPNGTLIQLHQGTPIMQLFLDSKEPIKNIETPFYRAKRYNRWLQFDYVIHSADDISHFYQ
                    ************************************************************

    COL             TAFPSHQANVLAYGNPKHQYLLQKSNESTTQQQYKKSFKINDQKPVLLYAPIGLVSAQQL
    N315            TAFPSHQANVLAYGNPKHQYLLQKRNESTTQQQYKKSFKINDQKPVLLYAPIGLVSAQQL
    NCTC8325        TAFPSHQANVLAYGNPKHQYLLQKSNESTTQQQYKKSFKINDQKPVLLYAPIGLVSAQQL
    Newman          TAFPSHQANVLAYGNPKHQYLLQKSNESTTQQQYKKSFKINDQKPVLLYAPIGLVSAQQL
    USA300_FPR3757  TAFPSHQANVLAYGNPKHQYLLQKSNESTTQQQYKKSFKINDQKPVLLYAPIGLVSAQQL
                    ************************ ***********************************

    COL             PLSDALFKAYHVVVQGVDEAILPEEALVAPKYLSAQDLILMSDVVITDYSNIIFDAMAID
    N315            PLSDALFKAYHVVVQGVDEAILPEEALVAPKYLSAQDLILMSDVVITDYSNIIFDAMAID
    NCTC8325        PLSDALFKAYHVVVQGVDEAILPEEALVAPKYLSAQDLILMSDVVITDYSNIIFDAMAID
    Newman          PLSDALFKAYHVVVQGVDEAILPEEALVAPKYLSAQDLILMSDVVITDYSNIIFDAMAID
    USA300_FPR3757  PLSDALFKAYHVVVQGVDEAILPEEALVAPKYLSAQDLILMSDVVITDYSNIIFDAMAID
                    ************************************************************

    COL             KTVALYTPNHSQYIESQGVNEDIWRHLSKIWYTDRQLLINNLISQAIPVIKYPQIQHKEQ
    N315            KTVALYTPNHSQYIESQGVNEDIWRHLSKIWYTDRQLLINNLISQAIPVIKYPQIQHKEQ
    NCTC8325        KTVALYTPNHSQYIESQGVNEDIWRHLSKIWYTDRQLLINNLISQAIPVIKYPQIQHKEQ
    Newman          KTVALYTPNHSQYIESQGVNEDIWRHLSKIWYTDRQLLINNLISQAIPVIKYPQIQHKEQ
    USA300_FPR3757  KTVALYTPNHSQYIESQGVNEDIWRHLSKIWYTDRQLLINNLISQAIPVIKYPQIQHKEQ
                    ************************************************************

    COL             PLESISQLILSKMTSNQ
    N315            PLESISQLILSKMTSNQ
    NCTC8325        PLESISQLILSKMTSNQ
    Newman          PLESISQLILSKMTSNQ
    USA300_FPR3757  PLESISQLILSKMTSNQ
                    *****************