From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005883000
  • symbol?:
  • description?: lipoprotein SA2158

      descriptions from strain specific annotations:

    • lipoprotein SA2158
    • putative lipoprotein
    • TpgX protein
    • Membrane lipoprotein
  • strand?: -
  • coordinates?: 5956213..5956842
  • synteny block?: BlockID0046280
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2307 (tpgX)
    08BA02176:
    C248_2415
    11819-97:
    MS7_2386
    71193:
    ST398NM01_2422
    ECT-R 2:
    ECTR2_2228
    ED133:
    SAOV_2415c
    ED98:
    SAAV_2433
    HO 5096 0412:
    SAEMRSA15_22690
    JH1:
    SaurJH1_2438
    JH9:
    SaurJH9_2392
    JKD6008:
    SAA6008_02406
    JKD6159:
    SAA6159_02272
    LGA251:
    SARLGA251_21540
    M013:
    M013TW_2329
    MRSA252:
    SAR2457
    MSHR1132:
    SAMSHR1132_21960
    MSSA476:
    SAS2259
    Mu3:
    SAHV_2352
    Mu50:
    SAV2368
    MW2:
    MW2289
    RF122:
    SAB2248c
    ST398:
    SAPIG2422
    T0131:
    SAT0131_02558 (murD)
    TCH60:
    TW20:
    SATW20_25000
    USA300_TCH1516:
    USA300HOU_2351
    VC40:
    SAVC_10710

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKRLVTGLLALSLFLAACGQDSDQQKDGNKEKDDKAKTEQQDKKTNDSSKDKKDNKDDSK
    N315            MKRLVTGLLALSLFLAACGQDSDQQKDSNKEKDDKAKTEQQDKKTNDSSKDKKDNKDDSK
    NCTC8325        MKRLVTGLLALSLFLAACGQDSDQQKDGNKEKDDKAKTEQQDKKTNDSSKDKKDNKDDSK
    Newman          MKRLVTGLLALSLFLAACGQDSDQQKDGNKEKDDKAKTEQQDKKTNDSSKDKKDNKDDSK
    USA300_FPR3757  MKRLVTGLLALSLFLAACGQDSDQQKDGNKEKDDKAKTEQQDKKTNDSSKDKKDNKDDSK
                    ***************************.********************************

    COL             DVNKDNKDNSANDNQQQSNSNATNNDQNQTNNNQSSNNQANNNQKSSYVAPYYGQNAAPV
    N315            DVNKDNKDNSANDNQQQSNSNATNNDQNQTNNNQSS-----NNQKSSYVAPYYGQNAAPV
    NCTC8325        DVNKDNKDNSANDNQQQSNSNATNNDQNQTNNNQSSNNQANNNQKSSYVAPYYGQNAAPV
    Newman          DVNKDNKDNSANDNQQQSNSNATNNDQNQTNNNQSSNNQANNNQKSSYVAPYYGQNAAPV
    USA300_FPR3757  DVNKDNKDNSANDNQQQSNSNATNNDQNQTNNNQSSNNQANNNQKSSYVAPYYGQNAAPV
                    ************************************     *******************

    COL             ARQIYPFNGNKNQALQQLPNFQTALNAANNEANKFGSNNKVYNDYSIEEHNGNYKYVFSF
    N315            ARQIYPFNGNKTQALQQLPNFQTALNAANNEANKFGSNNKVYNDYSIEEHNGNYKYVFSF
    NCTC8325        ARQIYPFNGNKNQALQQLPNFQTALNAANNEANKFGSNNKVYNDYSIEEHNGNYKYVFSF
    Newman          ARQIYPFNGNKNQALQQLPNFQTALNAANNEANKFGSNNKVYNDYSIEEHNGNYKYVFSF
    USA300_FPR3757  ARQIYPFNGNKNQALQQLPNFQTALNAANNEANKFGSNNKVYNDYSIEEHNGNYKYVFSF
                    ***********.************************************************

    COL             KDPNANGKYSIVTVDYTGQAMVTDPNYQQ
    N315            KDPNANGKYSIVTVDYTGQAMVTDPNYQQ
    NCTC8325        KDPNANGKYSIVTVDYTGQAMVTDPNYQQ
    Newman          KDPNANGKYSIVTVDYTGQAMVTDPNYQQ
    USA300_FPR3757  KDPNANGKYSIVTVDYTGQAMVTDPNYQQ
                    *****************************