From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005886000
  • symbol?:
  • description?: oxidoreductase

      descriptions from strain specific annotations:

    • oxidoreductase
    • quinone oxidoreductase , YhdH/YhfP
    • quinone oxidoreductase YhdH/YhfP
    • alcohol dehydrogenase
    • putative zinc-binding dehydrogenase
    • putative quinone oxidoreductase YhfP
    • alcohol dehydrogenase, zinc-containing
    • zinc-containing alcohol dehydrogenase superfamily protein
    • zinc (Zn2+) dependent dehydrogenase
    • zinc-binding alcohol dehydrogenase
    • YhdH/YhfP family quinone oxidoreductase
    • protein YhdH
  • strand?: +
  • coordinates?: 5957830..5958876
  • synteny block?: BlockID0046310
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2309
    08BA02176:
    C248_2417
    11819-97:
    MS7_2388 (yhfP)
    71193:
    ST398NM01_2424
    ECT-R 2:
    ECTR2_2230
    ED133:
    SAOV_2417
    ED98:
    SAAV_2435
    HO 5096 0412:
    SAEMRSA15_22710
    JH1:
    SaurJH1_2440
    JH9:
    SaurJH9_2394
    JKD6008:
    SAA6008_02408
    JKD6159:
    SAA6159_02274
    LGA251:
    SARLGA251_21560
    M013:
    M013TW_2331
    MRSA252:
    SAR2459
    MSHR1132:
    SAMSHR1132_21980
    MSSA476:
    SAS2261
    Mu3:
    SAHV_2354
    Mu50:
    SAV2370
    MW2:
    MW2291
    RF122:
    SAB2250
    ST398:
    SAPIG2424
    T0131:
    SAT0131_02560
    TCH60:
    HMPREF0772_10818
    TW20:
    SATW20_25020
    USA300_TCH1516:
    USA300HOU_2353
    VC40:
    SAVC_10720

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIETFKAFVIDKDESGKVTPTFKQLSPTDLPKGDVLIKVHYSGINYKDALATQDHNAVVK
    N315            MIETFKAFVIDKDESGKVTPTFKQLSPTDLPKGDVLIKVHYSGINYKDALATQDHNAVVK
    NCTC8325        ----------------------------------MLIKVHYSGINYKDALATQDHNAVVK
    Newman          MIETFKAFVIDKDESGKVTPTFKQLSPTDLPKGDVLIKVHYSGINYKDALATQDHNAVVK
    USA300_FPR3757  ----------------------------------MLIKVHYSGINYKDALATQDHNAVVK
                                                      :*************************

    COL             SYPMIPGIDLAGTIVESEAPGFEKGEQVIVTSYDLGVSHYGGFSEYARVKSEWIIKLPDT
    N315            SYPMIPGIDLAGTIVESEAPGFEKGEQVIVTSYDLGVSHYGGFSEYARVKSEWIIKLPDT
    NCTC8325        SYPMIPGIDLAGTIVESEAPGFEKGEQVIVTSYDLGVSHYGGFSEYARVKSEWIIKLPDT
    Newman          SYPMIPGIDLAGTIVESEAPGFEKGEQVIVTSYDLGVSHYGGFSEYARVKSEWIIKLPDT
    USA300_FPR3757  SYPMIPGIDLAGTIVESEAPGFEKGEQVIVTSYDLGVSHYGGFSEYARVKSEWIIKLPDT
                    ************************************************************

    COL             LTLEESMIYGTAGYTAGLAIERLEKVGMNIEDGPVLVRGASGGVGTLAVLMLNELGYKVI
    N315            LTLEESMIYGTAGYTAGLAIERLEKVGMNIEDGPVLVRGASGGVGTLAVLMLNELGYKVI
    NCTC8325        LTLEESMIYGTAGYTAGLAIERLEKVGMNIEDGPVLVRGASGGVGTLAVLMLNELGYKVI
    Newman          LTLEESMIYGTAGYTAGLAIERLEKVGMNIEDGPVLVRGASGGVGTLAVLMLNELGYKVI
    USA300_FPR3757  LTLEESMIYGTAGYTAGLAIERLEKVGMNIEDGPVLVRGASGGVGTLAVLMLNELGYKVI
                    ************************************************************

    COL             ASTGKQDVSDQLLELGAKEVIDRLPVEDDHKKPLASSTWQACVDPVGGEGINYVTKRLNH
    N315            ASTGKQDVSDQLLELGAKEVIDRLPVEDDHKKPLASSTWQACVDPVGGEGINYVTKRLNH
    NCTC8325        ASTGKQDVSDQLLELGAKEVIDRLPVEDDHKKPLASSTWQACVDPVGGEGINYVTKRLNH
    Newman          ASTGKQDVSDQLLELGAKEVIDRLPVEDDHKKPLASSTWQACVDPVGGEGINYVTKRLNH
    USA300_FPR3757  ASTGKQDVSDQLLELGAKEVIDRLPVEDDHKKPLASSTWQACVDPVGGEGINYVTKRLNH
                    ************************************************************

    COL             SGSIAVIGMTAGNTYTNSVFPHILRGVNILGIDSVFTAMKLRQRVWRRLAKDLMPENLHE
    N315            SGSIAVIGMTAGNTYTNSVFPHILRGVNILGIDSVFTAMKLRQRVWRRLAKDLKPENLHE
    NCTC8325        SGSITVIGMTAGNTYTNSVFPHILRGVNILGIDSVFTAMKLRQRVWRRLAKDLMPENLHE
    Newman          SGSIAVIGMTAGNTYTNSVFPHILRGVNILGIDSVFTAMKLRQRVWRRLAKDLMPENLHE
    USA300_FPR3757  SGSIAVIGMTAGNTYTNSVFPHILRGVNILGIDSVFTAMKLRQRVWRRLAKDLMPENLHE
                    ****:************************************************ ******

    COL             IKQVITFDELPEQLNKVIKHENKGRIVIDFGVDK
    N315            IKQVITFDELPEQLNKVINHENKGRIVIDFGVDK
    NCTC8325        IKQVITFDELPEQLNKVIKHENKGRIVIDFGVDK
    Newman          IKQVITFDELPEQLNKVIKHENKGRIVIDFGVDK
    USA300_FPR3757  IKQVITFDELPEQLNKVIKHENKGRIVIDFGVDK
                    ******************:***************