From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005894000
  • symbol?:
  • description?: ABC transporter

      descriptions from strain specific annotations:

    • ABC transporter
    • ABC-2 transporter family protein
    • membrane protein
    • ABC-2 type transporter family
    • Phage infection protein
  • strand?: -
  • coordinates?: 5963932..5965209
  • synteny block?: BlockID0046390
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2313
    08BA02176:
    C248_2422
    11819-97:
    MS7_2393
    71193:
    ST398NM01_2429
    ECT-R 2:
    ECTR2_2235
    ED133:
    SAOV_2422c
    ED98:
    SAAV_2440
    HO 5096 0412:
    SAEMRSA15_22750
    JH1:
    SaurJH1_2446
    JH9:
    SaurJH9_2400
    JKD6008:
    SAA6008_02413 (yhgE)
    JKD6159:
    SAA6159_02278 (yhgE)
    LGA251:
    SARLGA251_21600
    M013:
    M013TW_2336
    MRSA252:
    SAR2463
    MSHR1132:
    SAMSHR1132_22030
    MSSA476:
    SAS2266
    Mu3:
    SAHV_2358
    Mu50:
    SAV2374
    MW2:
    MW2296
    RF122:
    SAB2254c
    ST398:
    SAPIG2429
    T0131:
    SAT0131_02565
    TCH60:
    HMPREF0772_10814
    TW20:
    SATW20_25060
    USA300_TCH1516:
    USA300HOU_2359
    VC40:
    SAVC_10740

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNIFKNKLLWIAPIATMIILVIFSLAFYPAYNPKPKDLPIGILNEDKGTTIQDKNVNIGK
    N315            MNIFKNKLLWIAPIATMIILVIFSLAFYPAYNPKPKDLPIGILNEDKGTTIQDKNVNIGK
    NCTC8325        MNIFKNKLLWIAPIATMIILVIFSLAFYPAYNPKPKDLPIGILNEDKGTTIQDKNVNIGK
    Newman          MNIFKNKLLWIAPIATMIILVIFSLAFYPAYNPKPKDLPIGILNEDKGTTIQDKNVNIGK
    USA300_FPR3757  MNIFKNKLLWIAPIATMIILVIFSLAFYPAYNPKPKDLPIGILNEDKGTTIQDKNVNIGK
                    ************************************************************

    COL             KLEDKLLDSDSNKIKWVKVDSEKDLEKDLKDQKIFGVAIIDKDFSKDAMSKTQKVVMDSK
    N315            KLEDKLLDSDSNKIKWVKVDSEKDLEKDLKDQKIFGVAIIDKDFSKDAMSKTQKVVMDSK
    NCTC8325        KLEDKLLDSDSNKIKWVKVDSEKDLEKDLKDQKIFGVAIIDKDFSKDAMSKTQKVVMDSK
    Newman          KLEDKLLDSDSNKIKWVKVDSEKDLEKDLKDQKIFGVAIIDKDFSKDAMSKTQKVVMDSK
    USA300_FPR3757  KLEDKLLDSDSNKIKWVKVDSEKDLEKDLKDQKIFGVAIIDKDFSKDAMSKTQKVVMDSK
                    ************************************************************

    COL             KEEMQQKVASGEIPPQVVQQMKQKMGNQQVEVKQAKFKTIVSEGSSLQGSQIASAVLTGM
    N315            KEEMQQKVASGEIPPQVVQQMKQKMGNQQVEVKQAKFKTIVSEGSSLQGSQIASAVLTGM
    NCTC8325        KEEMQQKVASGEIPPQVVQQMKQKMGNQQVEVKQAKFKTIVSEGSSLQGSQIASAVLTGM
    Newman          KEEMQQKVASGEIPPQVVQQMKQKMGNQQVEVKQAKFKTIVSEGSSLQGSQIASAVLTGM
    USA300_FPR3757  KEEMQQKVASGEIPPQVVQQMKQKMGNQQVEVKQAKFKTIVSEGSSLQGSQIASAVLTGM
                    ************************************************************

    COL             GDNINAQITKQSLETLTSQNVKVNAADINGLTNPVKVDNEKLNKVKDHQAGGNAPFLMFM
    N315            GDNINAQITKQSLETLTSQNVKVNAADINGLTNPVKVDNEKLNKVKDHQAGGNAPFLMFM
    NCTC8325        GDNINAQITKQSLETLTSQNVKVNAADINGLTNPVKVDNEKLNKVKDHQAGGNAPFLMFM
    Newman          GDNINAQITKQSLETLTSQNVKVNAADINGLTNPVKVDNEKLNKVKDHQAGGNAPFLMFM
    USA300_FPR3757  GDNINAQITKQSLETLTSQNVKVNAADINGLTNPVKVDNEKLNKVKDHQAGGNAPFLMFM
                    ************************************************************

    COL             PIWIGSIVTSILLFFAFRTSNNIVVQHRIIASIGQMIFAVVAAFAGSFVYIYFMQGVQRF
    N315            PIWIGSIVTSILLFFAFRTSNNIVVQHRIIASIGQMIFAVVAAFAGSFVYIYFMQGVQGF
    NCTC8325        PIWIGSIVTSILLFFAFRTSNNIVVQHRIIASIGQMIFAVVAAFAGSFVYIYFMQGVQRF
    Newman          PIWIGSIVTSILLFFAFRTSNNIVVQHRIIASIGQMIFAVVAAFAGSFVYIYFMQGVQRF
    USA300_FPR3757  PIWIGSIVTSILLFFAFRTSNNIVVQHRIIASIGQMIFAVVAAFAGSFVYIYFMQGVQRF
                    ********************************************************** *

    COL             DFDHPNRIAIFVAFAILGFVGLILGVMVWLGMKSVPIFFILMFFSMQLVTLPKQMLPESY
    N315            DFDHPNRIAIFVAFAILGFVGLILGVMVWLGMKSVPIFFILMFFSMQLVTLPKQMLPESY
    NCTC8325        DFDHPNRIAIFVAFAILGFVGLILGVMVWLGMKSVPIFFILMFFSMQLVTLPKQMLPESY
    Newman          DFDHPNRIAIFVAFAILGFVGLILGVMVWLGMKSVPIFFILMFFSMQLVTLPKQMLPESY
    USA300_FPR3757  DFDHPNRIAIFVAFAILGFVGLILGVMVWLGMKSVPIFFILMFFSMQLVTLPKQMLPESY
                    ************************************************************

    COL             QKYVYDWNPFTHYATSVRELLYLNHHIELNSTMWMFIGFMIFGAVSSLVSAIVRKHSTKR
    N315            QKYVYDWNPFTHYATSVRELLYLNHHIELNSTMWMFIGFMIFGAVSSLVSAIVRKHSTKR
    NCTC8325        QKYVYDWNPFTHYATSVRELLYLNHHIELNSTMWMFIGFMIFGAVSSLVSAIVRKHSTKR
    Newman          QKYVYDWNPFTHYATSVRELLYLNHHIELNSTMWMFIGFMIFGAVSSLVSAIVRKHSTKR
    USA300_FPR3757  QKYVYDWNPFTHYATSVRELLYLNHHIELNSTMWMFIGFMIFGAVSSLVSAIVRKHSTKR
                    ************************************************************

    COL             TEVPS
    N315            TEVPS
    NCTC8325        TEVPS
    Newman          TEVPS
    USA300_FPR3757  TEVPS
                    *****