From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005897000
  • symbol?: scrA
  • description?: PTS sucrose transporter subunit IIBC

      descriptions from strain specific annotations:

    • PTS sucrose transporter subunit IIBC
    • PTS system sucrose-specific transporter subunit IIBC
    • PTS system, sucrose-specific IIBC component
    • PTS system, sucrose-specific IIBC components
    • PTS family beta-glucosides porter, IIABC component
    • PTS family sucrose porter component IIBC
    • PTS system, sucrose-specific IIBC components, putative
    • PTS system, sucrose-specific IIB component / PTS system, sucrose-specific IIC component
    • PTS system sucrose-specific IIBC component
    • PTS system trehalose-specific EIIBC component
  • strand?: -
  • coordinates?: 5967081..5968331
  • synteny block?: BlockID0046420
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA2167 (scrA)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2316 (scrA)
    08BA02176:
    C248_2425 (scrA)
    11819-97:
    MS7_2396
    71193:
    ST398NM01_2432
    ECT-R 2:
    ECTR2_2238 (treP)
    ED133:
    SAOV_2425c
    ED98:
    SAAV_2443
    HO 5096 0412:
    SAEMRSA15_22780 (scrA)
    JH1:
    SaurJH1_2449
    JH9:
    SaurJH9_2403
    JKD6008:
    SAA6008_02416
    JKD6159:
    SAA6159_02281
    LGA251:
    SARLGA251_21630 (scrA)
    M013:
    M013TW_2339
    MRSA252:
    SAR2466 (scrA)
    MSHR1132:
    SAMSHR1132_22060
    MSSA476:
    SAS2269
    Mu3:
    SAHV_2361 (scrA)
    Mu50:
    SAV2377 (scrA)
    MW2:
    MW2299 (scrA)
    RF122:
    SAB2257c (scrA)
    ST398:
    SAPIG2432
    T0131:
    SAT0131_02568
    TCH60:
    HMPREF0772_10811 (scrA)
    TW20:
    SATW20_25090 (scrA)
    USA300_TCH1516:
    USA300HOU_2362 (scrA)
    VC40:
    SAVC_10755

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNYKQSAEEILNAIGGEENLDAMAHCATRLRLVLNDESLVNEEALNNMDVVKGTFSTGGQ
    N315            MNYKQSAEDILNAIGGEENLDAMAHCATRLRLVLNDESLVNEEALNNMDVVKGTFSTGGQ
    NCTC8325        MNYKQSAEEILNAIGGEENLDAMAHCATRLRLVLNDESLVNEEALNNMDVVKGTFSTGGQ
    Newman          MNYKQSAEEILNAIGGEENLDAMAHCATRLRLVLNDESLVNEEALNNMDVVKGTFSTGGQ
    USA300_FPR3757  MNYKQSAEEILNAIGGEENLDAMAHCATRLRLVLNDESLVNEEALNNMDVVKGTFSTGGQ
                    ********:***************************************************

    COL             YQIIIGSGTVNKVFSELEKLTGKEASTTSEVKAQSAKNMNPLQRFVKMLSDIFVPIIPAI
    N315            YQIIIGSGTVNKVFSELEKLTGKEASTTSEVKAQSAKNMNPLQRFVKMLSDIFVPIIPAI
    NCTC8325        YQIIIGSGTVNKVFSELEKLTGKEASTTSEVKAQSAKNMNPLQRFVKMLSDIFVPIIPAI
    Newman          YQIIIGSGTVNKVFSELEKLTGKEASTTSEVKAQSAKNMNPLQRFVKMLSDIFVPIIPAI
    USA300_FPR3757  YQIIIGSGTVNKVFSELEKLTGKEASTTSEVKAQSAKNMNPLQRFVKMLSDIFVPIIPAI
                    ************************************************************

    COL             VAGGLLMGLNNILTAKDLFFSGKSLIDVYSQFAGLAEMINVFANAPFTLLPILIGFSAAK
    N315            VAGGLLMGLNNILTAKDLFFSGKSLIDVYSQFAGLAEMINVFANAPFTLLPILIGFSAAK
    NCTC8325        VAGGLLMGLNNILTAKDLFFSGKSLIDVYSQFAGLAEMINVFANAPFTLLPILIGFSAAK
    Newman          VAGGLLMGLNNILTAKDLFFSGKSLIDVYSQFAGLAEMINVFANAPFTLLPILIGFSAAK
    USA300_FPR3757  VAGGLLMGLNNILTAKDLFFSGKSLIDVYSQFAGLAEMINVFANAPFTLLPILIGFSAAK
                    ************************************************************

    COL             RFGGNPFLGAALGMILVHPSLMSAYDFPKAVEAGKAIPYWDVFGLHINQVGYQGQVLPML
    N315            RFGGNPFLGAVLGMILVHPSLMSAYDFPKAVEAGKAIPYWDVFGLHINQVGYQGQVLPML
    NCTC8325        RFGGNPFLGAALGMILVHPSLMSAYDFPKAVEAGKAIPYWDVFGLHINQVGYQGQVLPML
    Newman          RFGGNPFLGAALGMILVHPSLMSAYDFPKAVEAGKAIPYWDVFGLHINQVGYQGQVLPML
    USA300_FPR3757  RFGGNPFLGAALGMILVHPSLMSAYDFPKAVEAGKAIPYWDVFGLHINQVGYQGQVLPML
                    **********.*************************************************

    COL             VAAYILASIEKGLRKVIPTVLDNLLTPLLSIFITAFLTFSFVGPITRQLGYWLSDGLTWL
    N315            VAAYILASIEKGLRKVIPTVLDNLLTPLLSIFITAFLTFSFVGPITRQLGYWLSDGLTWL
    NCTC8325        VAAYILASIEKGLRKVIPTVLDNLLTPLLSIFITAFLTFSFVGPITRQLGYWLSDGLTWL
    Newman          VAAYILASIEKGLRKVIPTVLDNLLTPLLSIFITAFLTFSFVGPITRQLGYWLSDGLTWL
    USA300_FPR3757  VAAYILASIEKGLRKVIPTVLDNLLTPLLSIFITAFLTFSFVGPITRQLGYWLSDGLTWL
                    ************************************************************

    COL             YEFGGAIGGLIFGLLYAPIVITGMHHSFIAVETTLIADATKTGGSFIFPIATMSNVAQGG
    N315            YEFGGAIGGLIFGLLYAPIVITGMHHSFIAVETTLIADATKTGGSFIFPIATMSNVAQGG
    NCTC8325        YEFGGAIGGLIFGLLYAPIVITGMHHSFIAVETTLIADATKTGGSFIFPIATMSNVAQGG
    Newman          YEFGGAIGGLIFGLLYAPIVITGMHHSFIAVETTLIADATKTGGSFIFPIATMSNVAQGG
    USA300_FPR3757  YEFGGAIGGLIFGLLYAPIVITGMHHSFIAVETTLIADATKTGGSFIFPIATMSNVAQGG
                    ************************************************************

    COL             AAIAAFFIIKQNKKLKGVASAAGISALLGITEPAMFGVNLKLRYPFIGAIVGSGIGSAYI
    N315            AAIAAFFIIKQNKKLKGVASAAGISALLGITEPAMFGVNLKLRYPFIGAIVGSGIGSAYI
    NCTC8325        AAIAAFFIIKQNKKLKGVASAAGISALLGITEPAMFGVNLKLRYPFIGAIVGSGIGSAYI
    Newman          AAIAAFFIIKQNKKLKGVASAAGISALLGITEPAMFGVNLKLRYPFIGAIVGSGIGSAYI
    USA300_FPR3757  AAIAAFFIIKQNKKLKGVASAAGISALLGITEPAMFGVNLKLRYPFIGAIVGSGIGSAYI
                    ************************************************************

    COL             AFFKVKAIALGTAGLPGFISINPVHAGWLHYFVGMTISFIIAITVTLILSKRKANKEVVE
    N315            AFFKVKAIALGTAGLPGFISINPVHAGWLHYFVGMTISFIIAITVTLILSKRKANKEVVE
    NCTC8325        AFFKVKAIALGTAGLPGFISINPVHAGWLHYFVGMTISFIIAITVTLILSKRKANKEVVE
    Newman          AFFKVKAIALGTAGLPGFISINPVHAGWLHYFVGMTISFIIAITVTLILSKRKANKEVVE
    USA300_FPR3757  AFFKVKAIALGTAGLPGFISINPVHAGWLHYFVGMTISFIIAITVTLILSKRKANKEVVE
                    ************************************************************