From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005899000
  • symbol?:
  • description?: putative type II DNA modification enzyme

      descriptions from strain specific annotations:

    • putative type II DNA modification enzyme
    • type II DNA modification enzyme
  • strand?: +
  • coordinates?: 5968510..5969047
  • synteny block?: BlockID0046440
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2317
    08BA02176:
    C248_2426
    11819-97:
    MS7_2397
    71193:
    ST398NM01_2433
    ECT-R 2:
    ECTR2_2239
    ED133:
    SAOV_2426
    ED98:
    SAAV_2444
    HO 5096 0412:
    SAEMRSA15_22790
    JH1:
    SaurJH1_2450
    JH9:
    SaurJH9_2404
    JKD6008:
    SAA6008_02417
    JKD6159:
    SAA6159_02282
    LGA251:
    SARLGA251_21640
    M013:
    M013TW_2340
    MRSA252:
    SAR2467
    MSHR1132:
    SAMSHR1132_22070
    MSSA476:
    SAS2270
    Mu3:
    SAHV_2362
    Mu50:
    SAV2378
    MW2:
    MW2300
    RF122:
    SAB2258
    ST398:
    SAPIG2433
    T0131:
    SAT0131_02569 (ccrC)
    TCH60:
    HMPREF0772_10810
    TW20:
    SATW20_25100
    USA300_TCH1516:
    USA300HOU_2363
    VC40:
    SAVC_10760

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKERGYIEQLWREEKYHVLLHSQQSYQMIRNALKTDLSLHQVQQMIDVALLIEPSIGSVC
    N315            MKERGHIEQLWREEKYHVLLHSQQSYQMIRNALKTDLSLHQVQQMIDDALLIEPSIGSVC
    NCTC8325        MKERGYIEQLWREEKYHVLLHSQQSYQMIRNALKTDLSLHQVQQMIDVALLIEPSIGSVC
    Newman          MKERGYIEQLWREEKYHVLLHSQQSYQMIRNALKTDLSLHQVQQMIDVALLIEPSIGSVC
    USA300_FPR3757  MKERGYIEQLWREEKYHVLLHSQQSYQMIRNALKTDLSLHQVQQMIDVALLIEPSIGSVC
                    *****:***************************************** ************

    COL             NAFDHMWGYLKKCANEEERQQSKLLKADFINGKIDTQTLLDFLAELANKYDVQYLLQSRV
    N315            NAFDHMWGYFKKCANEEERKQSKLLKADFINGKIDTQTLLDFLAELANKYDVQYLLQSRV
    NCTC8325        NAFDHMWGYLKKCANEEERQQSKLLKADFINGKIDTQTLLDFLAELANKYDVQYLLQSRV
    Newman          NAFDHMWGYLKKCANEEERQQSKLLKADFINGKIDTQTLLDFLAELANKYDVQYLLQSRV
    USA300_FPR3757  NAFDHMWGYLKKCANEEERQQSKLLKADFINGKIDTQTLLDFLAELANKYDVQYLLQSRV
                    *********:*********:****************************************

    COL             LNTKRKR
    N315            LNTKRKR
    NCTC8325        LNTKRKR
    Newman          LNTKRKR
    USA300_FPR3757  LNTKRKR
                    *******