Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN005904000
  • symbol?:
  • description?: AraC family transcription regulator

      descriptions from strain specific annotations:

    • AraC family transcription regulator
    • AraC family transcriptional regulator
    • AraC family regulatory protein
    • transcription regulatory protein
    • AraC transcriptional regulator
    • transcriptional regulator AraC family protein
    • truncated AraC-like transcription regulatory protein
  • strand?: +
  • coordinates?: 5972114..5975167
  • synteny block?: BlockID0046480
  • occurrence?: in 50% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    C248_2428
    11819-97:
    71193:
    ST398NM01_2434
    ECT-R 2:
    ED133:
    SAOV_2427
    ED98:
    HO 5096 0412:
    SAEMRSA15_22800
    JH1:
    JH9:
    JKD6008:
    JKD6159:
    SAA6159_02283 (araC)
    LGA251:
    SARLGA251_21650
    M013:
    MRSA252:
    SAR2468
    MSHR1132:
    MSSA476:
    Mu3:
    Mu50:
    MW2:
    RF122:
    SAB2260
    ST398:
    SAPIG2434
    T0131:
    SAT0131_02570
    TCH60:
    HMPREF0772_10807
    TW20:
    USA300_TCH1516:
    USA300HOU_2364
    VC40:
    SAVC_10761

Genome Viewer[edit source | edit]

NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    NCTC8325        MTCQLKIHHTLSTIPSRNINNIMVLFSLTSKLNITINGETKDVSNYIILINHGDIYNINH
    Newman          MTCQLKIHHTLSTIPSRNINNIMVLFSLTSKLNITINGETKDVSNYIILINHGDIYNINH
    USA300_FPR3757  MTCQLKIHHTLSTIPSRNINNIMVLFSLTSKLNITINGETKDVSNYIILINHGDIYNINH
                    ************************************************************

    NCTC8325        GENIIELMIPVFYFYQQDDDFFNGYLDRHLLQSSNYIKSLIADLISTPTSSSLMGKNIGQ
    Newman          GENIIELMIPVFYFYQQDDDFFNGYLDRHLLQSSNYIKSLIADLISTPTSSSLMGKNIGQ
    USA300_FPR3757  GENIIELMIPVFYFYQQDDDFFNGYLDRHLLQSSNYIKSLIADLISTPTSSSLMGKNIGQ
                    ************************************************************

    NCTC8325        SIIDTLLKEAFIRIDHEYLPNIALSNPVFIDCVNYIHDNIDAHLSLKDIAMHCNISESYC
    Newman          SIIDTLLKEAFIRIDHEYLPNIALSNPVFIDCVNYIHDNIDAHLSLKDIAMHCNISESYC
    USA300_FPR3757  SIIDTLLKEAFIRIDHEYLPNIALSNPVFIDCVNYIHDNIDAHLSLKDIAMHCNISESYC
                    ************************************************************

    NCTC8325        SNLFVRYLSMNFKDYFTSIKLVNAINLLLSTKHSITTVSELAGFNSHTNFANQFKNYLHF
    Newman          SNLFVRYLSMNFKDYFTSIKLVNAINLLLSTKHSITTVSELAGFNSHTNFANQFKNYLHF
    USA300_FPR3757  SNLFVRYLSMNFKDYFTSIKLVNAINLLLSTKHSITTVSELAGFNSHTNFANQFKNYLHF
                    ************************************************************

    NCTC8325        SPKQFRSLVSKITEPPQIHFQQDNVSQFTELISTIDLTAQLATNTTDIHIDDFNPKDRSQ
    Newman          SPKQFRSLVSKITEPPQIHFQQDNVSQFTELISTIDLTAQLATNTTDIHIDDFNPKDRSQ
    USA300_FPR3757  SPKQFRSLVSKITEPPQIHFQQDNVSQFTELISTIDLTAQLATNTTDIHIDDFNPKDRSQ
                    ************************************************************

    NCTC8325        RAKVFVRFSNFNELFQFIFNEYYDINFEHLPKPVVFIDDIHDIEISQTNYNLLNRCFEKL
    Newman          RAKVFVRFSNFNELFQFIFNEYYDINFEHLPKPVVFIDDIHDIEISQTNYNLLNRCFEKL
    USA300_FPR3757  RAKVFVRFSNFNELFQFIFNEYYDINFEHLPKPVVFIDDIHDIEISQTNYNLLNRCFEKL
                    ************************************************************

    NCTC8325        FEKNIGLAIAIKSTQQFETMKQLILTFLQGNQDYKTSKKLVKFMLVFCSNSMTAEEIHLC
    Newman          FEKNIGLAIAIKSTQQFETMKQLILTFLQGNQDYKTSKKLVKFMLVFCSNSMTAEEIHLC
    USA300_FPR3757  FEKNIGLAIAIKSTQQFETMKQLILTFLQGNQDYKTSKKLVKFMLVFCSNSMTAEEIHLC
                    ************************************************************

    NCTC8325        HLKIKNKNKEIKYSVTVDGFLETYSTVEQVYDVMQRLKFHYYFIDIENSKTATHLITKNQ
    Newman          HLKIKNKNKEIKYSVTVDGFLETYSTVEQVYDVMQRLKFHYYFIDIENSKTATHLITKNQ
    USA300_FPR3757  HLKIKNKNKEIKYSVTVDGFLETYSTVEQVYDVMQRLKFHYYFIDIENSKTATHLITKNQ
                    ************************************************************

    NCTC8325        HYHQTDTHFEQYKKFILDSGISSTQFVYNNLSVSGFKYTNDGKNPIQLSDIVYHLIALLR
    Newman          HYHQTDTHFEQYKKFILDSGISSTQFVYNNLSVSGFKYTNDGKNPIQLSDIVYHLIALLR
    USA300_FPR3757  HYHQTDTHFEQYKKFILDSGISSTQFVYNNLSVSGFKYTNDGKNPIQLSDIVYHLIALLR
                    ************************************************************

    NCTC8325        YGGGISYQLLDDHSNYISLYNKYGSPLPLMHLYKMFRPFVNEDIEITNNYVLSRKDNNYH
    Newman          YGGGISYQLLDDHSNYISLYNKYGSPLPLMHLYKMFRPFVNEDIEITNNYVLSRKDNNYH
    USA300_FPR3757  YGGGISYQLLDDHSNYISLYNKYGSPLPLMHLYKMFRPFVNEDIEITNNYVLSRKDNNYH
                    ************************************************************

    NCTC8325        FLLFNKINDRYMSDVKQDFIFHNELPQDSLMIIKTLNHEHGSIQHLLPISDQLVYIEKEI
    Newman          FLLFNKINDRYMSDVKQDFIFHNELPQDSLMIIKTLNHEHGSIQHLLPISDQLVYIEKEI
    USA300_FPR3757  FLLFNKINDRYMSDVKQDFIFHNELPQDSLMIIKTLNHEHGSIQHLLPISDQLVYIEKEI
                    ************************************************************

    NCTC8325        LDELDKTNYPKTELAVQEETGRTFELKLNHDEVKYICFKPS
    Newman          LDELDKTNYPKTELAVQEETGRTFELKLNHDEVKYICFKPS
    USA300_FPR3757  LDELDKTNYPKTELAVQEETGRTFELKLNHDEVKYICFKPS
                    *****************************************