From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN005905000
  • symbol?: araC
  • description?: transcriptional regulator

      descriptions from strain specific annotations:

    • transcriptional regulator
    • AraC family transcriptional regulator
    • AraC family regulatory protein
    • bacterial regulatory helix-turn-helix s, AraC family protein
    • pseudogene
    • regulatory helix-turn-helix proteins, AraC family protein
    • transcription regulatory protein
  • strand?: +
  • coordinates?: 5972114..5975565
  • synteny block?: BlockID0046490
  • occurrence?: in 50% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2318
    08BA02176:
    11819-97:
    MS7_2398
    71193:
    ECT-R 2:
    ECTR2_2240
    ED133:
    ED98:
    SAAV_2445
    HO 5096 0412:
    JH1:
    SaurJH1_2452
    JH9:
    SaurJH9_2405
    JKD6008:
    SAA6008_02418 (araC)
    JKD6159:
    LGA251:
    M013:
    M013TW_2341
    MRSA252:
    MSHR1132:
    SAMSHR1132_22080
    MSSA476:
    SAS2271
    Mu3:
    SAHV_2365
    Mu50:
    SAV2381
    MW2:
    MW2301
    RF122:
    ST398:
    T0131:
    TCH60:
    TW20:
    SATW20_25110
    USA300_TCH1516:
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTCQLKIHHTLSTIPSRNINNIMVLFSLTSKLNITINGETKDVSNYIILINHGDIYNINH
    N315            MTCQLKIHHTLSTIPSRNINNIMVLFSLTSKLNITINGETKDVSNYIILINHGDIYNINH
                    ************************************************************

    COL             GENIIELMIPVFYFYQQDDDFFNGYLDRHLLQSSNYIKSLIADLISTPTSSSLMGKNIGQ
    N315            GENIIELMIPVFYFYQQDDDFFNGYLDRHLLQSSNYIKSLIADLISTPTSSSLMGKNIGQ
                    ************************************************************

    COL             SIIDTLLKEAFIRIDHEYLPNIALSNPVFIDCVNYIHDNIDAHLSLKDIAMHCNISESYC
    N315            SIIDTLLKEAFIRIDHEYLPNIALSNPVFIDCVNYIHDNIDAHLSLKDIAMHCNISESYC
                    ************************************************************

    COL             SNLFVRYLSMNFKDYFTSIKLVNAINLLLSTKHSITTVSELAGFNSHTNFANQFKNYLHF
    N315            SNLFVRYLSMNFKDYFTSIKLVNAINLLLSTKHSITTVSELAGFNSHTNFANQFKNYLHF
                    ************************************************************

    COL             SPKQFRSLVSKITEPPQIHFQQDNVSQFTELISTIDLTAQLATNTTDIHIDDFNPKDRSQ
    N315            SPKQFRSLVSKITEPPQIHFQQDNVSQFTELISTIDLTAQLATNTTDIHIDDFNPKDRSQ
                    ************************************************************

    COL             RAKVFVRFSNFNELFQFIFNEYYDINFEHLPKPVVFIDDIHDIEISQTNYNLLNRCFEKL
    N315            RAKVFVRFSNFNELFQFIFNEYYDINFEHLPKPVVFIDDIHDIEISQTNYNLLNRCFEKL
                    ************************************************************

    COL             FEKNIGLAIAIKSTQQFETMKQLILTFLQGNQDYKTSKKLVKFMLVFCSNSMTAEEIHLC
    N315            FEKNIGLAIAIKSTQQFETMKQLILTFLQGNQDYKTSKKLVKFMLVFCSNSMTAEEIHLC
                    ************************************************************

    COL             HLKIKNKNKEIKYSVTVDGFLETYSTVEQVYDVMQRLKFHYYFIDIENSKTATHLITKNQ
    N315            HLKIKNKNKEIKYSVTVDGFLETYSTVEQVYDVMQRLKFHYYFIDIENSKTATHLITKNQ
                    ************************************************************

    COL             HYHQTDTHFEQYKKFILDSGISSTQFVYNNLSVSGFKYTNDGKNPIQLSDIVYHLIALLR
    N315            HYHQTDTHFEQYKKFILDSGISSTQFVYNNLSVSGFKYTNDGKNPIQLSDIVYHLIALLR
                    ************************************************************

    COL             YGGGISYQLLDDHSNYISLYNKYGSPLPLMHLYKMFRPFVNEDIEITNNYVLSRKDNNYH
    N315            YGGGISYQLLDDHSNYISLYNKYGSPLPLMHLYKMFRPFVNEDIEITNNYVLSRKDNNYH
                    ************************************************************

    COL             FLLFNKINDRYMSDVKQDFIFHNELPQDSLMIIKTLNHEHGSIQHLLPISDQLVYIEKEI
    N315            FLLFNKINDRYMSDVKQDFIFHNELPQDSLMIIKTLNHEHGSIQHLLPISDQLVYIEKEI
                    ************************************************************

    COL             LDELDKTNYPKTELAVQEETGRTFELKLNHDEVKYICFKPS
    N315            LDELDKTNYPKTELAVQEETGRTFELKLNHDEVKYICFKPS
                    *****************************************