From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005909000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 5976340..5976708
  • synteny block?: BlockID0046530
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2320
    08BA02176:
    C248_2430
    11819-97:
    MS7_2400
    71193:
    ST398NM01_2436
    ECT-R 2:
    ECTR2_2242
    ED133:
    SAOV_2429
    ED98:
    SAAV_2448
    HO 5096 0412:
    SAEMRSA15_22820
    JH1:
    SaurJH1_2454
    JH9:
    SaurJH9_2407
    JKD6008:
    SAA6008_02422
    JKD6159:
    SAA6159_02285
    LGA251:
    SARLGA251_21670
    M013:
    M013TW_2343
    MRSA252:
    SAR2470
    MSHR1132:
    SAMSHR1132_22100
    MSSA476:
    SAS2273
    Mu3:
    SAHV_2367
    Mu50:
    SAV2383
    MW2:
    MW2303
    RF122:
    SAB2262
    ST398:
    SAPIG2436
    T0131:
    SAT0131_02572
    TCH60:
    HMPREF0772_10805
    TW20:
    SATW20_25130
    USA300_TCH1516:
    USA300HOU_2365
    VC40:
    SAVC_10780

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKKKGFGLGISLIAIMLIVCIVLVIMMMTGGKKDTYYGIMKDNTTIEKMISEKDESIEK
    N315            MKKKKGFGLGISLIAIMLIVCIVLVIMMMTGGKKDTYYGIMKDNTTIEKMISEKDESIEK
    NCTC8325        MKKKKGFGLGISLIAIMLIVCIVLVIMMMTGGKKDTYYGIMKDNTTIEKMISEKDESIEK
    Newman          MKKKKGFGLGISLIAIMLIVCIVLVIMMMTGGKKDTYYGIMKDNTTIEKMISEKDESIEK
    USA300_FPR3757  MKKKKGFGLGISLIAIMLIVCIVLVIMMMTGGKKDTYYGIMKDNTTIEKMISEKDESIEK
                    ************************************************************

    COL             NVKLPSDSDVKVKKGDFVIVYKLADSDKIVKVKKVDHDDVPHGLMMKIHDMGKMHMKH
    N315            NVKLPSDSDVKVKKGDFVIVYKLADSDKIVKVKKVDHDDVPHGLMMKIHDMGKMHMKH
    NCTC8325        NVKLPSDSDVKVKKGDFVIVYKLADSDKIVKVKKVDHDDVPHGLMMKIHDMGKMHMKH
    Newman          NVKLPSDSDVKVKKGDFVIVYKLADSDKIVKVKKVDHDDVPHGLMMKIHDMGKMHMKH
    USA300_FPR3757  NVKLPSDSDVKVKKGDFVIVYKLADSDKIVKVKKVDHDDVPHGLMMKIHDMGKMHMKH
                    **********************************************************