Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005920000
  • symbol?:
  • description?: transcriptional regulator

      descriptions from strain specific annotations:

    • transcriptional regulator
    • MerR family transcriptional regulator
    • TipAS antibiotic-recognition domain-containing protein
    • MerR family regulatory protein
    • transcriptional regulator, MerR family
    • merR family regulatory family protein
    • pseudogene
    • TipAS antibiotic-recognition domain family
    • HTH-type transcriptional activator tipA
  • strand?: +
  • coordinates?: 5985689..5986408
  • synteny block?: BlockID0046640
  • occurrence?: in 91% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2327
    08BA02176:
    C248_2437
    11819-97:
    71193:
    ST398NM01_2443
    ECT-R 2:
    ECTR2_2249
    ED133:
    SAOV_2436
    ED98:
    SAAV_2455
    HO 5096 0412:
    SAEMRSA15_22890
    JH1:
    SaurJH1_2462
    JH9:
    SaurJH9_2414
    JKD6008:
    SAA6008_02431
    JKD6159:
    LGA251:
    M013:
    M013TW_2350
    MRSA252:
    SAR2478
    MSHR1132:
    SAMSHR1132_22180
    MSSA476:
    SAS2281
    Mu3:
    SAHV_2374
    Mu50:
    SAV2390
    MW2:
    MW2312
    RF122:
    SAB2269
    ST398:
    SAPIG2443
    T0131:
    SAT0131_02581
    TCH60:
    HMPREF0772_10797
    TW20:
    SATW20_25200
    USA300_TCH1516:
    USA300HOU_2372
    VC40:
    SAVC_10820

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAYTYTLKDIIEITGVTKRTLHYYDEIGLLVPDKNDKNYRVYKQQDLEKLQKILILKSFD
    N315            MAYTYTLKDIIEITGVTKRTLHYYDEIGLLVPDKNDKNYRVYKQQDLEKLQKILILKSFD
    NCTC8325        MAYTYTLKDIIEITGVTKRTLHYYDEIGLLVPDKNDKNYRVYKQQDLEKLQKILILKSFD
    Newman          MAYTYTLKDIIEITGVTKRTLHYYDEIGLLVPDKNDKNYRVYKQQDLEKLQKILILKSFD
    USA300_FPR3757  MAYTYTLKDIIEITGVTKRTLHYYDEIGLLVPDKNDKNYRVYKQQDLEKLQKILILKSFD
                    ************************************************************

    COL             FDIAKIKQYISYDNEQLRKLLSEQISKLDKKISDLQLIRRSVCEFIKGLSLIDTSILNKT
    N315            FDIAKIKQYISYDNEQLRKLLSEQISKLDKKISDLQLIRRSVCEFIKGLSLIDTSILNKT
    NCTC8325        FDIAKIKQYISYDNEQLRKLLSEQISKLDKKISDLQLIRRSVCEFIKGLSLIDTSILNKT
    Newman          FDIAKIKQYISYDNEQLRKLLSEQISKLDKKISDLQLIRRSVCEFIKGLSLIDTSILNKT
    USA300_FPR3757  FDIAKIKQYISYDNEQLRKLLSEQISKLDKKISDLQLIRRSVCEFIKGLSLIDTSILNKT
                    ************************************************************

    COL             LQSQYDKEASIKYGHTKAYQSFIRRKDSLQSQDIRHKLTTIFNKFNHMSLSHYPIQDCSD
    N315            LQSQYDKEASIKYGHTKAYQSFIRRKDSLQSQDIRHKLTTIFNKFNHMSLSHYPIQDCSD
    NCTC8325        LQSQYDKEASIKYGHTKAYQSFIRRKDSLQSQDIRHKLTTIFNKFNHMSLSHYPIQDCSD
    Newman          LQSQYDKEASIKYGHTKAYQSFIRRKDSLQSQDIRHKLTTIFNKFNHMSLSHYPIQDCSD
    USA300_FPR3757  LQSQYDKEASIKYGHTKAYQSFIRRKDSLQSQDIRHKLTTIFNKFNHMSLSHYPIQDCSD
                    ************************************************************

    COL             LVFEWKAFMNTIADFDDETLCCIAKTYEDDTRFKDYFNSYDNQNLASYISEAVNYFLSNV
    N315            LVFEWKAFMNTIADFDDETLCCIAKTYEDDTRFKDYFNSYDNQNLASYISEAVNYFLSNV
    NCTC8325        LVFEWKAFMNTIADFDDETLCCIAKTYEDDTRFKDYFNSYDNQNLASYISEAVNYFLSNV
    Newman          LVFEWKAFMNTIADFDDETLCCIAKTYEDDTRFKDYFNSYDNQNLASYISEAVNYFLSNV
    USA300_FPR3757  LVFEWKAFMNTIADFDDETLCCIAKTYEDDTRFKDYFNSYDNQNLASYISEAVNYFLSNV
                    ************************************************************

    COL             NKSDNF
    N315            NKSDNF
    NCTC8325        NKSDNF
    Newman          NKSDNF
    USA300_FPR3757  NKSDNF
                    ******