From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005927000
  • symbol?: narH
  • description?: nitrate reductase subunit beta NarH

      descriptions from strain specific annotations:

    • nitrate reductase subunit beta NarH
    • nitrate reductase beta chain
    • respiratory nitrate reductase, beta subunit
    • Respiratory nitrate reductase beta chain
    • respiratory nitrate reductase subunit beta
    • nitrate reductase beta subunit
    • Nitrate reductase, beta subunit
    • nitrate reductase beta chain narH
  • strand?: -
  • coordinates?: 5990332..5991777
  • synteny block?: BlockID0046710
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2394 (narH)
    N315:
    SA2184 (narH)
    NCTC8325:
    Newman:
    NWMN_2296 (narH)
    USA300_FPR3757:
    04-02981:
    SA2981_2333 (narH)
    08BA02176:
    C248_2443 (narH)
    11819-97:
    MS7_2411 (narH)
    71193:
    ST398NM01_2449
    ECT-R 2:
    ECTR2_2255 (narH)
    ED133:
    SAOV_2441c
    ED98:
    SAAV_2461 (narH)
    HO 5096 0412:
    SAEMRSA15_22950 (narH)
    JH1:
    SaurJH1_2468
    JH9:
    SaurJH9_2420
    JKD6008:
    SAA6008_02437 (narY)
    JKD6159:
    SAA6159_02297 (narY)
    LGA251:
    SARLGA251_21780 (narH)
    M013:
    M013TW_2357
    MRSA252:
    SAR2485 (narH)
    MSHR1132:
    SAMSHR1132_22240
    MSSA476:
    SAS2287
    Mu3:
    SAHV_2380 (narH)
    Mu50:
    SAV2396 (narH)
    MW2:
    MW2318 (narH)
    RF122:
    SAB2275c (narH)
    ST398:
    SAPIG2449 (narH)
    T0131:
    SAT0131_02587 (pyrP)
    TCH60:
    HMPREF0772_10791 (narH)
    TW20:
    SATW20_25260 (narH)
    USA300_TCH1516:
    USA300HOU_2378 (narH)
    VC40:
    SAVC_10850

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKIKAQVAMVLNLDKCIGCHTCSVTCKNTWTNRPGAEYMWFNNVETKPGVGYPKRWEDQE
    N315            MKIKAQVAMVLNLDKCIGCHTCSVTCKNTWTNRPGAEYMWFNNVETKPGVGYPKRWEDQE
    NCTC8325        --------------------------------------MWFNNVETKPGVGYPKRWEDQE
    Newman          MKIKAQVAMVLNLDKCIGCHTCSVTCKNTWTNRPGAEYMWFNNVETKPGVGYPKRWEDQE
    USA300_FPR3757  --------------------------------------MWFNNVETKPGVGYPKRWEDQE
                                                          **********************

    COL             HYKGGWVLNRKGKLELKSGSRISKIALGKIFYNPDMPLIKDYYEPWNYNYEHLTTAKSGK
    N315            HYKGGWVLNRKGKLELKSGSRISKIALGKIFYNPDMPLIKDYYEPWNYNYEHLTTAKSGK
    NCTC8325        HYKGGWVLNRKGKLELKSGSRISKIALGKIFYNPDMPLIKDYYEPWNYNYEHLTTAKSGK
    Newman          HYKGGWVLNRKGKLELKSGSRISKIALGKIFYNPDMPLIKDYYEPWNYNYEHLTTAKSGK
    USA300_FPR3757  HYKGGWVLNRKGKLELKSGSRISKIALGKIFYNPDMPLIKDYYEPWNYNYEHLTTAKSGK
                    ************************************************************

    COL             HSPVARAYSEITGDNIEIEWGPNWEDDLAGGHVTGPKDPNIQKIEEDIKFQFDETFMMYL
    N315            HSPVARAYSEITGDNIEIEWGPNWEDDLAGGHVTGPKDPNIQKIEEDIKFQFDETFMMYL
    NCTC8325        HSPVARAYSEITGDNIEIEWGPNWEDDLAGGHVTGPKDPNIQKIEEDIKFQFDETFMMYL
    Newman          HSPVARAYSEITGDNIEIEWGPNWEDDLAGGHVTGPKDPNIQKIEEDIKFQFDETFMMYL
    USA300_FPR3757  HSPVARAYSEITGDNIEIEWGPNWEDDLAGGHVTGPKDPNIQKIEEDIKFQFDETFMMYL
                    ************************************************************

    COL             PRLCEHCLNPSCVASCPSGAMYKRDEDGIVLVDQDACRGWRYCMTGCPYKKVYFNWKTNK
    N315            PRLCEHCLNPSCVASCPSGAMYKRDEDGIVLVDQDACRGWRYCMTGCPYKKVYFNWKTNK
    NCTC8325        PRLCEHCLNPSCVASCPSGAMYKRDEDGIVLVDQDACRGWRYCMTGCPYKKVYFNWKTNK
    Newman          PRLCEHCLNPSCVASCPSGAMYKRDEDGIVLVDQDACRGWRYCMTGCPYKKVYFNWKTNK
    USA300_FPR3757  PRLCEHCLNPSCVASCPSGAMYKRDEDGIVLVDQDACRGWRYCMTGCPYKKVYFNWKTNK
                    ************************************************************

    COL             AEKCTFCFPRIEAGMPTVCSETCTGRMRYLGVLLYDADRVHEAASAVDEKDLYEKQLDIF
    N315            AEKCTFCFPRIEAGMPTVCSETCTGRMRYLGVLLYDADRVHEAASAVDEKGLYEKQLDIF
    NCTC8325        AEKCTFCFPRIEAGMPTVCSETCTGRMRYLGVLLYDADRVHEAASAVDEKDLYEKQLDIF
    Newman          AEKCTFCFPRIEAGMPTVCSETCTGRMRYLGVLLYDADRVHEAASAVDEKDLYEKQLDIF
    USA300_FPR3757  AEKCTFCFPRIEAGMPTVCSETCTGRMRYLGVLLYDADRVHEAASAVDEKDLYEKQLDIF
                    **************************************************.*********

    COL             LNPFDEEVIAQAEKDGIGYDWIEAAQNSPIYKLAIEYKLAFPLHPEFRTMPMVWYCPPLS
    N315            LNPFDEEVIAQAEKDGIGYDWIEAAQNSPIYKLAIEYKLAFPLHPEFRTMPMVWYCPPLS
    NCTC8325        LNPFDEEVIAQAEKDGIGYDWIEAAQNSPIYKLAIEYKLAFPLHPEFRTMPMVWYCPPLS
    Newman          LNPFDEEVIAQAEKDGIGYDWIEAAQNSPIYKLAIEYKLAFPLHPEFRTMPMVWYCPPLS
    USA300_FPR3757  LNPFDEEVIAQAEKDGIGYDWIEAAQNSPIYKLAIEYKLAFPLHPEFRTMPMVWYCPPLS
                    ************************************************************

    COL             PIMSYFEGKNTTQNPDAIFPAIEEMRLPIEYLANIFTAGDTEPVKGALQRMAMMRSYMRS
    N315            PIMSYFEGKNTTQNPDAIFPAIEEMRLPIEYLANIFTAGDTEPVKGALQRMAMMRSYMRS
    NCTC8325        PIMSYFEGKNTTQNPDAIFPAIEEMRLPIEYLANIFTAGDTEPVKGALQRMAMMRSYMRS
    Newman          PIMSYFEGKNTTQNPDAIFPAIEEMRLPIEYLANIFTAGDTEPVKGALQRMAMMRSYMRS
    USA300_FPR3757  PIMSYFEGKNTTQNPDAIFPAIEEMRLPIEYLANIFTAGDTEPVKGALQRMAMMRSYMRS
                    ************************************************************

    COL             QVTQQPFDTSRLERLGITERQTKDMYRLLGLAKYEDRFVIPTSHKETYLDTYHAQGSTGY
    N315            QVTQQPFDTSRLERLGITERQTKDMYRLLGLAKYEDRFVIPTSHKETYLDTYHAQGSTGY
    NCTC8325        QVTQQPFDTSRLERLGITERQTKDMYRLLGLAKYEDRFVIPTSHKETYLDTYHAQGSTGY
    Newman          QVTQQPFDTSRLERLGITERQTKDMYRLLGLAKYEDRFVIPTSHKETYLDTYHAQGSTGY
    USA300_FPR3757  QVTQQPFDTSRLERLGITERQTKDMYRLLGLAKYEDRFVIPTSHKETYLDTYHAQGSTGY
                    ************************************************************

    COL             NYGGEHFGDNCEGCGVAVGSGKTGQEIYNENFYGGIFRD
    N315            NYGGEHFGDNCEGCGVAVGSGKTGQEIYNENFYGGIFRD
    NCTC8325        NYGGEHFGDNCEGCGVAVGSGKTGQEIYNENFYGGIFRD
    Newman          NYGGEHFGDNCEGCGVAVGSGKTGQEIYNENFYGGIFRD
    USA300_FPR3757  NYGGEHFGDNCEGCGVAVGSGKTGQEIYNENFYGGIFRD
                    ***************************************