From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005940000
  • symbol?:
  • description?: prevent-host-death protein

      descriptions from strain specific annotations:

    • prevent-host-death protein
    • addiction module antitoxin
    • prevent-host-death family protein
    • addiction module, antitoxin
    • addiction module antitoxin, Axe family
    • antitoxin YefM
    • prevent-host-death family antitoxin
  • strand?: -
  • coordinates?: 6006237..6006488
  • synteny block?: BlockID0046840
  • occurrence?: in 88% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2345
    08BA02176:
    11819-97:
    MS7_2423 (yefM)
    71193:
    ECT-R 2:
    ECTR2_2267
    ED133:
    SAOV_2454c
    ED98:
    SAAV_2473
    HO 5096 0412:
    SAEMRSA15_23070
    JH1:
    SaurJH1_2481
    JH9:
    SaurJH9_2433
    JKD6008:
    SAA6008_02449
    JKD6159:
    SAA6159_02309
    LGA251:
    SARLGA251_21900
    M013:
    M013TW_2369
    MRSA252:
    SAR2498
    MSHR1132:
    SAMSHR1132_22360
    MSSA476:
    SAS2299
    Mu3:
    SAHV_2392
    Mu50:
    SAV2408
    MW2:
    MW2330
    RF122:
    SAB2288c
    ST398:
    T0131:
    SAT0131_02599 (rpoZ)
    TCH60:
    HMPREF0772_10779
    TW20:
    SATW20_25380
    USA300_TCH1516:
    USA300HOU_2388
    VC40:
    SAVC_10910

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIIKNYSYARQNLKALMTKVNDDSDMVTVTSTDDKNVVIMSESDYNSMMETLYLQQNPNN
    N315            MIIKNYSYARQNLKALMTKVNDDSDMVTVTSTDDKNVVIMSESDYNSMMETLYLQQNPNN
    NCTC8325        MIIKNYSYARQNLKALMTKVNDDSDMVTVTSTDDKNVVIMSESDYNSMMETLYLQQNPNN
    USA300_FPR3757  MIIKNYSYARQNLKALMTKVNDDSVMVTVTSTDDKNVVIMSESDYNSMMETLYLQQNPNN
                    ************************ ***********************************

    COL             AEHLAQSIADLERGKTITKDIDV
    N315            AEHLAQSIADLERGKTITKDIDV
    NCTC8325        AEHLAQSIADLERGKTITKDIDV
    USA300_FPR3757  AEHLAQSIADLERGKTITKDIDV
                    ***********************