From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005943000
  • symbol?: dsbA
  • description?: protein-disulfide isomerase

      descriptions from strain specific annotations:

    • protein-disulfide isomerase
    • lipoprotein
    • putative lipoprotein
    • Protein-disulfide isomerase, DsbA-like protein
    • chain A, Crystal Structure Of Staphylococcus aureus subsp. aureus ECT-R 2 Dsba
    • disulfide bond protein A
    • DsbA family thiol:disulfide interchange protein
    • DSBA-like thioredoxin domain-containing protein
    • lipoprotein, putative
    • protein-disulfide isomerase-like protein
  • strand?: -
  • coordinates?: 6007660..6008259
  • synteny block?: BlockID0046870
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_2308 (dsbA)
    USA300_FPR3757:
    04-02981:
    SA2981_2346
    08BA02176:
    C248_2454
    11819-97:
    MS7_2424
    71193:
    ST398NM01_2460
    ECT-R 2:
    ECTR2_2268
    ED133:
    SAOV_2455c
    ED98:
    SAAV_2474
    HO 5096 0412:
    SAEMRSA15_23080
    JH1:
    SaurJH1_2482
    JH9:
    SaurJH9_2434
    JKD6008:
    SAA6008_02450
    JKD6159:
    SAA6159_02310
    LGA251:
    SARLGA251_21910
    M013:
    M013TW_2370
    MRSA252:
    SAR2499
    MSHR1132:
    SAMSHR1132_22370
    MSSA476:
    SAS2300
    Mu3:
    SAHV_2393
    Mu50:
    SAV2409
    MW2:
    MW2331
    RF122:
    SAB2289c
    ST398:
    SAPIG2460
    T0131:
    SAT0131_02600
    TCH60:
    HMPREF0772_10778
    TW20:
    SATW20_25390
    USA300_TCH1516:
    USA300HOU_2390
    VC40:
    SAVC_10915

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKKLLTLFIVSMLILTACGKKESATTSSKNGKPLVVVYGDYKCPYCKELDEKVMPKLRK
    N315            MTKKLLTLFIVSMLILTACGKKESATTSSKNGKPLVVIYGDYKCPYCKELDEKVMPKLRK
    NCTC8325        MTKKLLTLFIVSMLILTACGKKESATTSSKNGKPLVVVYGDYKCPYCKELDEKVMPKLRK
    Newman          MTKKLLTLFIVSMLILTACGKKESATTSSKNGKPLVVVYGDYKCPYCKELDEKVMPKLRK
    USA300_FPR3757  MTKKLLTLFIVSMLILTACGKKESATTSSKNGKPLVVVYGDYKCPYCKELDEKVMPKLRK
                    *************************************:**********************

    COL             NYIDNHKVEYQFVNLAFLGKDSIVGSRASHAVLMYAPKSFLDFQKQLFAAQQDENKEWLT
    N315            NYIDNHKVEYQFVNLAFLGKDSIVGSRASHAVLMYAPKSFLDFQKQLFAAQQDENKEWLT
    NCTC8325        NYIDNHKVEYQFVNLAFLGKDSIVGSRASHAVLMYAPKSFLDFQKQLFAAQQDENKEWLT
    Newman          NYIDNHKVEYQFVNLAFLGKDSIVGSRASHAVLMYAPKSFLDFQKQLFAAQQDENKEWLT
    USA300_FPR3757  NYIDNHKVEYQFVNLAFLGKDSIVGSRASHAVLMYAPKSFLDFQKQLFAAQQDENKEWLT
                    ************************************************************

    COL             KELLDKHIKQLHLDKETENKIIKDYKTKDSKSWKAAEKDKKIAKDNHIKTTPTAFINGEK
    N315            KELLDKHIKQLHLDKETENKIIKDYKTKDSKSWKAAEKDKKIAKDNHIKTTPTAFINGEK
    NCTC8325        KELLDKHIKQLHLDKETENKIIKDYKTKDSKSWKAAEKDKKIAKDNHIKTTPTAFINGEK
    Newman          KELLDKHIKQLHLDKETENKIIKDYKTKDSKSWKAAEKDKKIAKDNHIKTTPTAFINGEK
    USA300_FPR3757  KELLDKHIKQLHLDKETENKIIKDYKTKDSKSWKAAEKDKKIAKDNHIKTTPTAFINGEK
                    ************************************************************

    COL             VEDPYDYESYEKLLKDKIK
    N315            VEDPYDYESYEKLLKDKIK
    NCTC8325        VEDPYDYESYEKLLKDKIK
    Newman          VEDPYDYESYEKLLKDKIK
    USA300_FPR3757  VEDPYDYESYEKLLKDKIK
                    *******************