From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: saupan005946000
  • symbol?: tcyC
  • description?: ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • ABC transporter ATP-binding protein
    • amino acid ABC transporter ATP-binding protein
    • amino acid ABC transporter, ATP-binding protein
    • L-cystine import ATP-binding protein tcyC
    • ABC superfamily ATP binding cassette transporter, ABC protein
    • ABC transporter-like protein
    • L-cystine import ATP-binding protein TcyN
  • strand?: -
  • coordinates?: 6010244..6010975
  • synteny block?: BlockID0046900
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2349
    08BA02176:
    C248_2457
    11819-97:
    MS7_2427 (tcyC)
    71193:
    ST398NM01_2463
    ECT-R 2:
    ECTR2_2271
    ED133:
    SAOV_2458c
    ED98:
    SAAV_2477
    HO 5096 0412:
    SAEMRSA15_23110
    JH1:
    SaurJH1_2485
    JH9:
    SaurJH9_2437
    JKD6008:
    SAA6008_02453
    JKD6159:
    SAA6159_02313
    LGA251:
    SARLGA251_21940
    M013:
    M013TW_2373
    MRSA252:
    SAR2502
    MSHR1132:
    SAMSHR1132_22400
    MSSA476:
    SAS2303
    Mu3:
    SAHV_2396
    Mu50:
    SAV2412
    MW2:
    MW2334
    RF122:
    SAB2292c
    ST398:
    SAPIG2463
    T0131:
    SAT0131_02603
    TCH60:
    HMPREF0772_10775
    TW20:
    SATW20_25420
    USA300_TCH1516:
    USA300HOU_2393
    VC40:
    SAVC_10930

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIQLTNIHKSFNDVEVIKGIDLSVEQGEVVTLIGRSGSGKTTLLRMINALEIPTEGTVYV
    N315            MIQLNNIHKSFNDVEVIKGIDLSVEQGEVVTLIGRSGSGKTTLLRMINALEIPTEGTVYV
    NCTC8325        MIQLNNIHKSFNDVEVIKGIDLSVEQGEVVTLIGRSGSGKTTLLRMINALEIPTEGTVYV
    Newman          MIQLNNIHKSFNDVEVIKGIDLSVEQGEVVTLIGRSGSGKTTLLRMINALEIPTEGTVYV
    USA300_FPR3757  MIQLNNIHKSFNDVEVIKGIDLSVEQGEVVTLIGRSGSGKTTLLRMINALEIPTEGTVYV
                    ****.*******************************************************

    COL             NGKTYTSKDKKSQIEVRKQSGMVFQSYNLFPHKTALENVMEGLITVKKLKKDEARGKSLE
    N315            NGKTYTSKDKKSQIEVRKQSGMVFQSYNLFPHKTALENVMEGLITVKKLKKDEARGKSLE
    NCTC8325        NGKTYTSKDKKSQIEVRKQSGMVFQSYNLFPHKTALENVMEGLITVKKLKKDEARGKSLE
    Newman          NGKTYTSKDKKSQIEVRKQSGMVFQSYNLFPHKTALENVMEGLITVKKLKKDEARGKSLE
    USA300_FPR3757  NGKTYTSKDKKSQIEVRKQSGMVFQSYNLFPHKTALENVMEGLITVKKLKKDEARGKSLE
                    ************************************************************

    COL             LLEKVGLTHVKDQRPHALSGGQQQRVAIARALAMNPKVMLFDEPTSALDPELVNDVLKVI
    N315            LLEKVGLTHVKDQRPHALSGGQQQRVAIARALAMNPKVMLFDEPTSALDPELVNDVLKVI
    NCTC8325        LLEKVGLTHVKDQRPHALSGGQQQRVAIARALAMNPKVMLFDEPTSALDPELVNDVLKVI
    Newman          LLEKVGLTHVKDQRPHALSGGQQQRVAIARALAMNPKVMLFDEPTSALDPELVNDVLKVI
    USA300_FPR3757  LLEKVGLTHVKDQRPHALSGGQQQRVAIARALAMNPKVMLFDEPTSALDPELVNDVLKVI
                    ************************************************************

    COL             KDLANEGMTMVIVTHEMRFAKEVSNNIVFIHEGMIGEQGAPEEMFNRPKTEELRRFLNVI
    N315            KDLANEGMTMVIVTHEMRFAKEVSNNIVFIHEGMIGEQGAPEEMFNRPKTEELRRFLNVI
    NCTC8325        KDLANEGMTMVIVTHEMRFAKEVSNNIVFIHEGMIGEQGAPEEMFNRPKTEELRRFLNVI
    Newman          KDLANEGMTMVIVTHEMRFAKEVSNNIVFIHEGMIGEQGAPEEMFNRPKTEELRRFLNVI
    USA300_FPR3757  KDLANEGMTMVIVTHEMRFAKEVSNNIVFIHEGMIGEQGAPEEMFNRPKTEELRRFLNVI
                    ************************************************************

    COL             NEE
    N315            NEE
    NCTC8325        NEE
    Newman          NEE
    USA300_FPR3757  NEE
                    ***