From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005947000
  • symbol?: tcyB
  • description?: ABC transporter permease

      descriptions from strain specific annotations:

    • ABC transporter permease
    • amino acid ABC transporter permease
    • amino acid ABC transporter, permease protein
    • polar amino acid ABC transporter inner membrane subunit
    • ABC transporter ATP-binding protein
    • transport system membrane protein
    • L-cystine transport system permease protein tcyB
    • ABC superfamily ATP binding cassette transporter, membrane protein
    • ABC transporter membrane-spanning permease -glutamine transport
  • strand?: -
  • coordinates?: 6010972..6011466
  • synteny block?: BlockID0046910
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2350
    08BA02176:
    C248_2458
    11819-97:
    MS7_2428 (tcyB)
    71193:
    ST398NM01_2464
    ECT-R 2:
    ECTR2_2272
    ED133:
    SAOV_2459c
    ED98:
    SAAV_2478
    HO 5096 0412:
    SAEMRSA15_23120
    JH1:
    SaurJH1_2486
    JH9:
    SaurJH9_2438
    JKD6008:
    SAA6008_02454
    JKD6159:
    SAA6159_02314
    LGA251:
    SARLGA251_21950
    M013:
    M013TW_2374
    MRSA252:
    SAR2503
    MSHR1132:
    SAMSHR1132_22410
    MSSA476:
    SAS2304
    Mu3:
    SAHV_2397
    Mu50:
    SAV2413
    MW2:
    MW2335
    RF122:
    SAB2293c
    ST398:
    SAPIG2464
    T0131:
    SAT0131_02604
    TCH60:
    HMPREF0772_10774 (tcyB)
    TW20:
    SATW20_25430
    USA300_TCH1516:
    USA300HOU_2394
    VC40:
    SAVC_10935

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVKMFLNLNSEQQHALDAAKQAFGPMLEGLVKYSIPITLVTFVLGLIIALFTALMRISTS
    N315            ------------------------------------------------------------
    NCTC8325        ---MFLNLNSEQQHALDAAKQAFGPMLEGLVKYSIPITLVTFVLGLIIALFTALMRISTS
    Newman          ---MFLNLNSEQQHALDAAKQAFGPMLEGLVKYSIPITLVTFVLGLIIALFTALMRISTS
    USA300_FPR3757  ---MFLNLNSEQQHALDAAKQAFGPMLEGLVKYSIPITLVTFVLGLIIALFTALMRISTS
                                                                                

    COL             KILRSISRVYVSIIRGTPMIVQLFIIFYGIPELGRLLTNDADNQWTLAPVVAAIIGLSLN
    N315            ------------------MIVQLFIIFYGIPELGRLLTNDADNQWTLAPVVAAIIGLSLN
    NCTC8325        KILRSISRVYVSIIRGTPMIVQLFIIFYGIPELGRLLTNDADNQWTLAPVVAAIIGLSLN
    Newman          KILRSISRVYVSIIRGTPMIVQLFIIFYGIPELGRLLTNDADNQWTLAPVVAAIIGLSLN
    USA300_FPR3757  KILRSISRVYVSIIRGTPMIVQLFIIFYGIPELGRLLTNDADNQWTLAPVVAAIIGLSLN
                                      ******************************************

    COL             VGAYASEIIRGGIISIPKGQTEAAYSIGMTYGQTIQRIILPQAIRVSIPALGNTFLSLIK
    N315            VGAYASEIIRGGIISIPKGQTEAAYSIGMTYGQTIQRIILPQAIRVSIPALGNTFLSLIK
    NCTC8325        VGAYASEIIRGGIISIPKGQTEAAYSIGMTYGQTIQRIILPQAIRVSIPALGNTFLSLIK
    Newman          VGAYASEIIRGGIISIPKGQTEAAYSIGMTYGQTIQRIILPQAIRVSIPALGNTFLSLIK
    USA300_FPR3757  VGAYASEIIRGGIISIPKGQTEAAYSIGMTYGQTIQRIILPQAIRVSIPALGNTFLSLIK
                    ************************************************************

    COL             DTSLLGFILVAEMFRKAQEVASTTYEYLTIYVLVALMYWVVCFIISIIQGIYESYIERGY
    N315            DTSLLGFILVAEMFRKAQEVASTTYEYLTIYVLVALMYWVVCFIISIIQGIYESYIERGY
    NCTC8325        DTSLLGFILVAEMFRKAQEVASTTYEYLTIYVLVALMYWVVCFIISIIQGIYESYIERGY
    Newman          DTSLLGFILVAEMFRKAQEVASTTYEYLTIYVLVALMYWVVCFIISIIQGIYESYIERGY
    USA300_FPR3757  DTSLLGFILVAEMFRKAQEVASTTYEYLTIYVLVALMYWVVCFIISIIQGIYESYIERGY
                    ************************************************************

    COL             RS
    N315            RS
    NCTC8325        RS
    Newman          RS
    USA300_FPR3757  RS
                    **