From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005982000
  • symbol?:
  • description?: bicyclomycin resistance protein TcaB

      descriptions from strain specific annotations:

    • bicyclomycin resistance protein TcaB
    • Bcr/CflA subfamily drug resistance transporter
    • drug resistance transporter, Bcr/CflA subfamily protein
    • putative transporter protein
    • drug resistance transporter Bcr/CflA subfamily protein
    • major facilitator superfamily bicyclomycin:cation symporter
    • MFS family major facilitator transporter, bicyclomycin:cation symporter
    • Drug resistance transporter, Bcr/CflA subfamily
    • major facilitator superfamily protein (MFS)
  • strand?: +
  • coordinates?: 6042968..6044179
  • synteny block?: BlockID0047260
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2437 (bcr)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2371 (tcaB)
    08BA02176:
    C248_2483
    11819-97:
    MS7_2448
    71193:
    ST398NM01_2486
    ECT-R 2:
    ECTR2_2292
    ED133:
    SAOV_2484
    ED98:
    SAAV_2500 (bcr)
    HO 5096 0412:
    SAEMRSA15_23340
    JH1:
    SaurJH1_2509
    JH9:
    SaurJH9_2460
    JKD6008:
    SAA6008_02475 (bcr)
    JKD6159:
    SAA6159_02332 (bcr)
    LGA251:
    SARLGA251_22150
    M013:
    M013TW_2397
    MRSA252:
    SAR2524
    MSHR1132:
    SAMSHR1132_22620
    MSSA476:
    SAS2326
    Mu3:
    SAHV_2418
    Mu50:
    SAV2434
    MW2:
    MW2358
    RF122:
    SAB2316
    ST398:
    SAPIG2486
    T0131:
    SAT0131_02631 (clfB)
    TCH60:
    HMPREF0772_10754 (bcr)
    TW20:
    SATW20_25630
    USA300_TCH1516:
    USA300HOU_2420 (bcr)
    VC40:
    SAVC_11045

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQSTKTKTKHFSFLLLITLGVMTAFGPLTIDMYVPSLPKVQGDFGSTTSEIQLTLSFTMI
    N315            MQSTKTKTKHFSFLLLITLGVMTAFGPLTIDMYVPSLPKVQGDFGSTTSEIQLTLSFTMI
    NCTC8325        MQSTKTKTKHFSFLLLITLGVMTAFGPLTIDMYVPSLPKVQGDFGSTTSEIQLTLSFTMI
    Newman          MQSTKTKTKHFSFLLLITLGVMTAFGPLTIDMYVPSLPKVQGDFGSTTSEIQLTLSFTMI
    USA300_FPR3757  MQSTKTKTKHFSFLLLITLGVMTAFGPLTIDMYVPSLPKVQGDFGSTTSEIQLTLSFTMI
                    ************************************************************

    COL             GLALGQFIFGPLSDAFGRKRIAVSILIIFILVSGLSMFVDQLPLFLTLRFIQGLTGGGVI
    N315            GLALGQFIFGPLSDAFGRKRIAVSILIIFILVSGLSMFVDQLPLFLTLRFIQGLTGGGVI
    NCTC8325        GLALGQFIFGPLSDAFGRKRIAVSILIIFILVSGLSMFVDQLPLFLTLRFIQGLTGGGVI
    Newman          GLALGQFIFGPLSDAFGRKRIAVSILIIFILVSGLSMFVDQLPLFLTLRFIQGLTGGGVI
    USA300_FPR3757  GLALGQFIFGPLSDAFGRKRIAVSILIIFILVSGLSMFVDQLPLFLTLRFIQGLTGGGVI
                    ************************************************************

    COL             VIAKASAGDKFSGNALAKFLASLMVVNGIITILAPLAGGLALSVATWRSIFTILTIVALI
    N315            VIAKASAGDKFSGNALAKFLASLMVVNGIITILAPLAGGLALSVATWRSIFTILTIVALI
    NCTC8325        VIAKASAGDKFSGNALAKFLASLMVVNGIITILAPLAGGLALSVATWRSIFTILTIVALI
    Newman          VIAKASAGDKFSGNALAKFLASLMVVNGIITILAPLAGGLALSVATWRSIFTILTIVALI
    USA300_FPR3757  VIAKASAGDKFSGNALAKFLASLMVVNGIITILAPLAGGLALSVATWRSIFTILTIVALI
                    ************************************************************

    COL             ILIGVASQLPKTSKDELKQVNFSSVIKDFGSLLKKPAFIIPMLLQGLTYVMLFSYSSASP
    N315            ILIGVASQLPKTSKDELKQVNFSSVIKDFGSLLKKPAFIIPMLLQGLTYVMLFSYSSASP
    NCTC8325        ILIGVASQLPKTSKDELKQVNFSSVIKDFGSLLKKPAFIIPMLLQGLTYVMLFSYSSASP
    Newman          ILIGVASQLPKTSKDELKQVNFSSVIKDFGSLLKKPAFIIPMLLQGLTYVMLFSYSSASP
    USA300_FPR3757  ILIGVASQLPKTSKDELKQVNFSSVIKDFGSLLKKPAFIIPMLLQGLTYVMLFSYSSASP
                    ************************************************************

    COL             FITQKLYNMTPQQFSIMFAVNGVGLIIVSQVVALLVEKLHRHILLIILTIIQVVGVALII
    N315            FITQKLYNMTPQQFSIMFAVNGVGLIIVSQVVALLVEKLHRHILLIILTIIQVVGVALII
    NCTC8325        FITQKLYNMTPQQFSIMFAVNGVGLIIVSQVVALLVEKLHRHILLIILTIIQVVGVALII
    Newman          FITQKLYNMTPQQFSIMFAVNGVGLIIVSQVVALLVEKLHRHILLIILTIIQVVGVALII
    USA300_FPR3757  FITQKLYNMTPQQFSIMFAVNGVGLIIVSQVVALLVEKLHRHILLIILTIIQVVGVALII
                    ************************************************************

    COL             LTLTFHLPLWVLLIAFFLNVCPVTSIGPLGFTMAMEERTGGSGNASSLLGLFQFILGGAV
    N315            LTLTFHLPLWVLLIAFFLNVCPVTSIGPLGFTMAMEERTGGSGNASSLLGLFQFILGGAV
    NCTC8325        LTLTFHLPLWVLLIAFFLNVCPVTSIGPLGFTMAMEERTGGSGNASSLLGLFQFILGGAV
    Newman          LTLTFHLPLWVLLIAFFLNVCPVTSIGPLGFTMAMEERTGGSGNASSLLGLFQFILGGAV
    USA300_FPR3757  LTLTFHLPLWVLLIAFFLNVCPVTSIGPLGFTMAMEERTGGSGNASSLLGLFQFILGGAV
                    ************************************************************

    COL             APLVGLKGEFNTSPYMIIIFITAILLVSLQIIYFKMIKKQHVA
    N315            APLVGLKGEFNTSPYMIIIFITAILLVSLQIIYFKMIKKQHVA
    NCTC8325        APLVGLKGEFNTSPYMIIIFITAILLVSLQIIYFKMIKKQHVA
    Newman          APLVGLKGEFNTSPYMIIIFITAILLVSLQIIYFKMIKKQHVA
    USA300_FPR3757  APLVGLKGEFNTSPYMIIIFITAILLVSLQIIYFKMIKKQHVA
                    *******************************************